Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S16 |
NCBI Accession ID | CP001032.1 |
Organism | Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) |
Left | 4035516 |
Right | 4035797 |
Strand | + |
Nucleotide Sequence | ATGGCTCTCAAAATCCGTCTCACCAAGGTTGGCTCCGTGCATCAGCCGCTCTATCGCGTCGTCGTCGCCGAAGCCCGTTCGCGTCGCGATGGCGATGCCGTCGAAAACCTCGGCACCTACACGCCCAAGAGCAAGGGCAGTCCGATCAAACTCAACATGGAGCGGGTCGACTACTGGCTGAGCAAGGGCGCGCTGCCCACCAACACGATGCACGCCATGATCAAGAAGGCGCGCCGCAGCGCTGCCGCCCAAGCCGAGGCCGCCCCGGCCGCGAGCGCCTGA |
Sequence | MALKIRLTKVGSVHQPLYRVVVAEARSRRDGDAVENLGTYTPKSKGSPIKLNMERVDYWLSKGALPTNTMHAMIKKARRSAAAQAEAAPAASA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 21398538 |
Domain | CDD:412339 |
Functional Category | Ribosomal_protein |
Uniprot ID | B1ZZH6 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4035516 | 4035797 | + | NC_010571.1 | Opitutus terrae PB90-1 |
2 | 3622986 | 3623255 | + | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
3 | 1145135 | 1145392 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
4 | 2619331 | 2619570 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
5 | 2617772 | 2618035 | + | NC_010814.1 | Geobacter lovleyi SZ |
6 | 93088 | 93363 | - | NZ_CP033732.1 | Staphylococcus hominis |
7 | 890130 | 890405 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
8 | 2789733 | 2789981 | - | NZ_CP011663.1 | Clostridium sporogenes |
9 | 1712062 | 1712337 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
10 | 1159735 | 1160010 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
11 | 1230265 | 1230540 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
12 | 1185586 | 1185861 | + | NZ_LT906460.1 | Staphylococcus simiae |
13 | 1276715 | 1276945 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
14 | 1767477 | 1767716 | - | NZ_CP054142.1 | Treponema parvum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01746.23 | 0.93 | 13 | 691 | same-strand | tRNA (Guanine-1)-methyltransferase |
2 | PF01245.22 | 0.93 | 13 | 1531 | same-strand | Ribosomal protein L19 |
3 | PF01782.20 | 0.79 | 11 | 262 | same-strand | RimM N-terminal domain |
4 | PF05239.18 | 0.71 | 10 | 239.5 | same-strand | PRC-barrel domain |
5 | PF00448.24 | 0.79 | 11 | 308.5 | same-strand | SRP54-type protein, GTPase domain |
6 | PF02978.21 | 0.79 | 11 | 147 | same-strand | Signal peptide binding domain |
7 | PF02881.21 | 0.79 | 11 | 308.5 | same-strand | SRP54-type protein, helical bundle domain |