Result : EXP00858
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00858 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 4440669 |
| Right | 4440818 |
| Strand | - |
| Nucleotide Sequence | ATCATATGTCACAACATGAACAGTTCTGTCAGGCTTGCGGAATGCCGATGTCGGCACCAGATGCACACAGTGCCAGTGATCAATATTGTGCGTAATGCAGCGACAGCAACGGCAATCTCAAACCCTGGGAAGAAGCGGTATCAGGTTTAG |
| Sequence | IICHNMNSSVRLAECRCRHQMHTVPVINIVRNAATATAISNPGKKRYQV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4532166 | 4532300 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 487530 | 487664 | + | NZ_CP033744.1 | Citrobacter freundii |
| 3 | 3750936 | 3751070 | - | NZ_CP033744.1 | Citrobacter freundii |
| 4 | 3641775 | 3641909 | - | NZ_CP017279.1 | Enterobacter ludwigii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017279.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00359.24 | 0.67 | 2 | 4397.5 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 2 | PF13847.8 | 1.0 | 3 | 136.5 | same-strand | Methyltransferase domain |
| 3 | PF13649.8 | 1.0 | 3 | 136.5 | same-strand | Methyltransferase domain |
| 4 | PF08241.14 | 1.0 | 3 | 136.5 | same-strand | Methyltransferase domain |
| 5 | PF08242.14 | 1.0 | 3 | 136.5 | same-strand | Methyltransferase domain |
| 6 | PF09857.11 | 1.0 | 3 | 1784.0 | same-strand | Putative toxin of bacterial toxin-antitoxin pair |
| 7 | PF12674.9 | 0.67 | 2 | -134 | same-strand | Putative zinc ribbon domain |
++ More..