Result : EXP00855
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00855 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1948225 |
| Right | 1948335 |
| Strand | - |
| Nucleotide Sequence | TTGAGCCAAAAAAGGAACGCGGCCGTCAGATTAAAGCCGCGGGACAAAGTCCATAATTTCCAAGAGTTGTTGAATTTCCCAGCTTTTTTGAAAGCCTTTGTATCATACTAA |
| Sequence | LSQKRNAAVRLKPRDKVHNFQELLNFPAFLKAFVSY |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2667754 | 2667864 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2044424 | 2044534 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2043078 | 2043188 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00576.23 | 1.0 | 2 | 3709 | opposite-strand | HIUase/Transthyretin family |
| 2 | PF00174.21 | 1.0 | 2 | 2596 | opposite-strand | Oxidoreductase molybdopterin binding domain |
| 3 | PF01794.21 | 1.0 | 2 | 1960 | opposite-strand | Ferric reductase like transmembrane component |
| 4 | PF09223.13 | 1.0 | 2 | 1053 | opposite-strand | ZinT (YodA) periplasmic lipocalin-like zinc-recruitment |
++ More..