| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP001032.1 |
| Organism | Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) |
| Left | 4918228 |
| Right | 4918458 |
| Strand | + |
| Nucleotide Sequence | ATGGCTAGAATCTGTGCAATCACCGGTCGCCGGCCCGTCAAGGGCTCGATCATCAACCGCAAAGGTCAGTCGAAGAAGAGCGGCGGCATCGGCACGCACGTGACCACCATCACGAAGCGCAAGTTTCGGCCGAACCTCCAGCGCATCCGCGTGAAGCTGCCGAACGGCGGCACCAAGCGCATGTTGGTGTCCGTCAAGGCCCTGAAGGCCGGTCTGGTCGAAAAGGCCTGA |
| Sequence | MARICAITGRRPVKGSIINRKGQSKKSGGIGTHVTTITKRKFRPNLQRIRVKLPNGGTKRMLVSVKALKAGLVEKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 21398538 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1ZYG2 |
| ORF Length (Amino Acid) | 76 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4918228 | 4918458 | + | NC_010571.1 | Opitutus terrae PB90-1 |
| 2 | 117841 | 118071 | + | NZ_CP023344.1 | Nibricoccus aquaticus |
| 3 | 2664980 | 2665210 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
| 4 | 1496304 | 1496534 | + | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00814.27 | 1.0 | 4 | 2633.0 | opposite-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
| 2 | PF03572.20 | 1.0 | 4 | 1278.5 | opposite-strand | Peptidase family S41 |
| 3 | PF13180.8 | 1.0 | 4 | 1278.5 | opposite-strand | PDZ domain |
| 4 | PF17820.3 | 1.0 | 4 | 1278.5 | opposite-strand | PDZ domain |
| 5 | PF00595.26 | 1.0 | 4 | 1278.5 | opposite-strand | PDZ domain |