Result : A0QNJ3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized PE family protein PE35 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) |
| Left | 85248 |
| Right | 85541 |
| Strand | + |
| Nucleotide Sequence | ATGCAACCGATGACACACAATCCGGGTGCGGAAGCCGTTGCGGCGCAAGTTATCGCAAATGCAGCACGTGGTCTGGCCGGTGGCACCACCGCCTCGGCCGCGGTCACCGCATTGGTGCCTGCAGGCGCTGACGAGGTCTCGGCGCTGGCCGCCGTGGCGTTCGCCAGCGAGGGCGTCGAGGCTCTTGCGGCGAATGCGTTCGCGCAGGAGGAGCTGACGCGCGCAGGTGCCGCGTTCGCCGAGATCGCGGGCATCTACAACGCCGTGGACGCCGCCAACGCGGCCACGATGTAG |
| Sequence | MQPMTHNPGAEAVAAQVIANAARGLAGGTTASAAVTALVPAGADEVSALAAVAFASEGVEALAANAFAQEELTRAGAAFAEIAGIYNAVDAANAATM |
| Source of smORF | Swiss-Prot |
| Function | Part of the ESX-1 / type VII specialized secretion system (T7SS), which exports several proteins including EsxA and EsxB (Probable). Plays a role in DNA conjugation, in at least a donor strain (Pubmed:15314236). {ECO:0000269|Pubmed:15314236, ECO:0000305}. |
| Pubmed ID | 17295914 18955433 15314236 |
| Domain | CDD:395748 |
| Functional Category | Others |
| Uniprot ID | A0QNJ3 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 85732 | 86025 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 1509076 | 1509369 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 3589341 | 3589634 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 4 | 2350272 | 2350565 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 5 | 413592 | 413885 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 6 | 55194 | 55487 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 7 | 1281084 | 1281380 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 8 | 1357751 | 1358044 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 9 | 2283605 | 2283898 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 10 | 3483672 | 3483968 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 11 | 7457252 | 7457545 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 12 | 69312 | 69608 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 13 | 4221277 | 4221570 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 14 | 1370471 | 1370767 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 15 | 74848 | 75144 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 16 | 3548510 | 3548806 | + | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 17 | 4440253 | 4440546 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 18 | 68529 | 68825 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 19 | 88073 | 88369 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 20 | 5611588 | 5611884 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 21 | 4440027 | 4440320 | - | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 22 | 662753 | 663049 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 23 | 3694516 | 3694812 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 24 | 67471 | 67767 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 25 | 4395992 | 4396288 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 26 | 1381865 | 1382161 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 27 | 4321273 | 4321566 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 28 | 4825845 | 4826138 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 29 | 3953345 | 3953638 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 30 | 4350745 | 4351044 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 31 | 120047 | 120343 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 32 | 5548123 | 5548419 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 33 | 4421119 | 4421415 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 34 | 3373626 | 3373922 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 35 | 3014395 | 3014730 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 36 | 3171696 | 3171992 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 37 | 1688028 | 1688324 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 38 | 4635865 | 4636161 | - | NZ_AP022581.1 | Mycobacterium lacus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00004.31 | 0.94 | 34 | 5634.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 2 | PF17866.3 | 0.83 | 30 | 5634.5 | same-strand | AAA lid domain |
| 3 | PF05108.15 | 1.0 | 36 | 4152 | same-strand | Type VII secretion system ESX-1, transport TM domain B |
| 4 | PF01580.20 | 0.94 | 34 | 1023.5 | same-strand | FtsK/SpoIIIE family |
| 5 | PF00823.21 | 1.0 | 36 | 44 | same-strand | PPE family |
| 6 | PF06013.14 | 1.0 | 36 | 1568 | same-strand | Proteins of 100 residues with WXG |
| 7 | PF10824.10 | 0.89 | 32 | 1446 | same-strand | Excreted virulence factor EspC, type VII ESX diderm |
| 8 | PF01656.25 | 0.92 | 33 | 2197 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 9 | PF08817.12 | 0.83 | 30 | 3613.0 | same-strand | WXG100 protein secretion system (Wss), protein YukD |
++ More..