Result : B1ZY08
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) |
| NCBI Accession ID | CP001032.1 |
| Organism | Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) |
| Left | 2418679 |
| Right | 2418972 |
| Strand | + |
| Nucleotide Sequence | ATGCCAACGATCTTGACGCAGGCGGACATCCAGCAGGTGCTCGGCGAACTAAAAGGCTGGGCTTGGGAGCGCGATGCGCTCGAAAAGACGTATCGGTTCGGCAGCTTTCGCGAGGCGATGAGCTTCATGGTGCGCGCGGCGTTCGAGGCCGAGGCGCTGAACCACCATCCCGAATGGGCCAACGTTTACGATCGCGTGACCGTCCGGCTCGCCACGCACGATGCAGGCGGGAAGGTGACCGCGAAGGATGTCGAGCTGGCGCGGCGGTTCGAGAAGATCTCGTGGGTGGGATAG |
| Sequence | MPTILTQADIQQVLGELKGWAWERDALEKTYRFGSFREAMSFMVRAAFEAEALNHHPEWANVYDRVTVRLATHDAGGKVTAKDVELARRFEKISWVG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00942. Profile Description: N/A. Pterin 4 alpha carbinolamine dehydratase is also known as DCoH (dimerization cofactor of hepatocyte nuclear factor 1-alpha). |
| Pubmed ID | 21398538 |
| Domain | CDD:412663 |
| Functional Category | Others |
| Uniprot ID | B1ZY08 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 66
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2418679 | 2418972 | + | NC_010571.1 | Opitutus terrae PB90-1 |
| 2 | 4722696 | 4722989 | - | NZ_CP023344.1 | Nibricoccus aquaticus |
| 3 | 4191605 | 4191898 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
| 4 | 1463031 | 1463276 | + | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 5 | 2431338 | 2431622 | + | NC_014230.1 | Croceibacter atlanticus HTCC2559 |
| 6 | 3458644 | 3458886 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 7 | 1809652 | 1809915 | + | NZ_LR884459.1 | Psychrobacter arenosus |
| 8 | 164331 | 164594 | - | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 9 | 1344674 | 1344952 | + | NC_018656.1 | Candidatus Nitrosopumilus sediminis |
| 10 | 1869791 | 1870066 | + | NZ_CP026995.1 | Nitrosopumilus ureiphilus |
| 11 | 3378865 | 3379158 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 12 | 2618000 | 2618248 | + | NZ_CP011071.1 | Muricauda lutaonensis |
| 13 | 1288110 | 1288388 | + | NZ_CP026993.1 | Nitrosopumilus cobalaminigenes |
| 14 | 1306504 | 1306779 | + | NZ_CP026994.1 | Nitrosopumilus oxyclinae |
| 15 | 365111 | 365386 | - | NZ_CP011070.1 | Nitrosopumilus adriaticus |
| 16 | 154919 | 155167 | - | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 17 | 198047 | 198310 | - | NZ_CP014945.1 | Psychrobacter alimentarius |
| 18 | 1650242 | 1650535 | - | NZ_CP012678.1 | Psychrobacter urativorans |
| 19 | 3408653 | 3408895 | - | NZ_CP022957.1 | Maribacter cobaltidurans |
| 20 | 2696765 | 2697037 | - | NC_015945.1 | Muricauda ruestringensis DSM 13258 |
| 21 | 257577 | 257819 | - | NZ_CP021324.1 | Candidatus Nitrosomarinus catalina |
| 22 | 1685262 | 1685537 | - | NZ_CP024808.1 | Candidatus Nitrosotenuis aquarius |
| 23 | 1081351 | 1081650 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 24 | 993841 | 994131 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 25 | 566170 | 566472 | - | NZ_CP004393.1 | Celeribacter indicus |
| 26 | 1321817 | 1322059 | + | NC_018655.1 | Candidatus Nitrosopumilus koreensis AR1 |
| 27 | 3449916 | 3450221 | - | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 28 | 1463266 | 1463514 | - | NZ_CP053923.1 | Defluviicoccus vanus |
| 29 | 782191 | 782445 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 30 | 3943308 | 3943592 | - | NZ_CP024199.1 | Thalassospira marina |
| 31 | 2355635 | 2355880 | - | NC_018013.1 | Aequorivita sublithincola DSM 14238 |
| 32 | 1936507 | 1936794 | - | NZ_CP032050.1 | Euzebyella marina |
| 33 | 506490 | 506780 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 34 | 6976837 | 6977127 | + | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 35 | 298600 | 298890 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 36 | 356476 | 356778 | + | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 37 | 1586044 | 1586349 | - | NZ_CP071454.1 | Rhizobium lentis |
| 38 | 2658680 | 2658946 | - | NZ_CP071057.1 | Marinicauda algicola |
| 39 | 4284938 | 4285243 | - | NZ_CP071604.1 | Rhizobium binae |
| 40 | 3487371 | 3487613 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 41 | 502980 | 503282 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 42 | 3428722 | 3428967 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 43 | 2503768 | 2504058 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 44 | 390595 | 390897 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 45 | 5738349 | 5738585 | - | NZ_CP030265.1 | Skermanella pratensis |
| 46 | 3332539 | 3332841 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 47 | 3907881 | 3908144 | - | NZ_CP034998.1 | Rhizobium acidisoli |
| 48 | 2293720 | 2294010 | - | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 49 | 837278 | 837550 | + | NC_010170.1 | Bordetella petrii |
| 50 | 2932045 | 2932287 | + | NZ_CP054021.1 | Rhizobium indicum |
| 51 | 6960065 | 6960355 | + | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 52 | 4305966 | 4306271 | - | NZ_CP013532.1 | Rhizobium phaseoli |
| 53 | 4786673 | 4786915 | - | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 54 | 1285636 | 1285938 | + | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 55 | 3439647 | 3439949 | - | NZ_LR723670.1 | Pseudorhizobium flavum |
| 56 | 308139 | 308441 | + | NC_017082.1 | Bradyrhizobium cosmicum |
| 57 | 1067375 | 1067662 | + | NZ_CP026100.1 | Caulobacter flavus |
| 58 | 4079564 | 4079869 | - | NZ_CP020906.1 | Rhizobium etli |
| 59 | 5529714 | 5530004 | - | NZ_CP042906.1 | Hypericibacter terrae |
| 60 | 334107 | 334409 | + | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 61 | 2922984 | 2923226 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 62 | 8213210 | 8213512 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 63 | 712481 | 712759 | + | NC_010645.1 | Bordetella avium 197N |
| 64 | 8221950 | 8222213 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 65 | 3047651 | 3047953 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 66 | 73808 | 74101 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
++ More..