Result : EXP00831
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00831 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2394483 |
| Right | 2394638 |
| Strand | - |
| Nucleotide Sequence | CTGGGAGAGCGCTTGCATGGCATGCAAGAGGTCAGCGGTTCGATCCCGCTTAGCTCCACCAAATTTCCAACCCTCGCTGCAAAGCGGGGGTTTTTTGTCTCTGCTTTTTGCCGCTTTTGTAATACAGTCTACGTCCGGGTTAGTGCCGCCTGGTGA |
| Sequence | LGERLHGMQEVSGSIPLSSTKFPTLAAKRGFFVSAFCRFCNTVYVRVSAAW |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3244863 | 3244997 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2517946 | 2518080 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2519357 | 2519491 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3063636 | 3063770 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1358173 | 1358322 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 6 | 995129 | 995275 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 7 | 2078986 | 2079141 | + | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 8 | 3981740 | 3981868 | + | NZ_CP036299.1 | Planctopirus ephydatiae |
| 9 | 419593 | 419733 | - | NZ_CP012160.1 | Octadecabacter temperatus |
| 10 | 3921436 | 3921570 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 11 | 456123 | 456287 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 12 | 3273687 | 3273812 | - | NZ_CP026377.1 | Mixta gaviniae |
| 13 | 60877 | 61041 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 14 | 767378 | 767521 | - | NZ_CP059565.1 | Neisseria wadsworthii |
| 15 | 290083 | 290217 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00749.23 | 0.71 | 10 | 1183 | same-strand | tRNA synthetases class I (E and Q), catalytic domain |
| 2 | PF19269.1 | 0.71 | 10 | 1183 | same-strand | Anticodon binding domain |
++ More..