Result : B1ZWC4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP001032.1 |
| Organism | Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) |
| Left | 4683868 |
| Right | 4684047 |
| Strand | + |
| Nucleotide Sequence | ATGGCCAATCCGAAACGCAAGCAGTCCAAACGCCGCAGCGCCAACCGCCGCGCCGCTAACGCTTTCATCGCTCCCGAGTTCGCCAAAGATCCGACCGATGGCAGTGCCTTCCGTCCGCACCGCGTGAATCCGAAGAATGGCATGTATCGCGGTCGCCAAGTGCTGAACGTCGAGGTCTGA |
| Sequence | MANPKRKQSKRRSANRRAANAFIAPEFAKDPTDGSAFRPHRVNPKNGMYRGRQVLNVEV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 21398538 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1ZWC4 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 66
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4683868 | 4684047 | + | NC_010571.1 | Opitutus terrae PB90-1 |
| 2 | 573892 | 574071 | + | NZ_CP023344.1 | Nibricoccus aquaticus |
| 3 | 2953943 | 2954119 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
| 4 | 3564988 | 3565167 | - | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
| 5 | 6037517 | 6037702 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 6 | 3171744 | 3171929 | - | NZ_CP016616.1 | Microvirga ossetica |
| 7 | 3618025 | 3618213 | + | NZ_CP039546.1 | Methylorubrum populi |
| 8 | 2506765 | 2506953 | - | NZ_CP029550.1 | Methylobacterium durans |
| 9 | 3588580 | 3588765 | + | NZ_CP045423.1 | Microvirga thermotolerans |
| 10 | 2377756 | 2377941 | + | NZ_CP029553.1 | Methylobacterium terrae |
| 11 | 295438 | 295623 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 12 | 5824801 | 5824989 | + | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 13 | 6028787 | 6028975 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 14 | 85576 | 85755 | - | NZ_LR134529.1 | Bartonella vinsonii |
| 15 | 4867676 | 4867864 | + | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 16 | 493598 | 493786 | - | NZ_CP046052.1 | Methylocystis heyeri |
| 17 | 5439210 | 5439398 | + | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 18 | 156037 | 156225 | - | NZ_CP044331.1 | Methylocystis parvus |
| 19 | 1702323 | 1702502 | - | NC_010103.1 | Brucella canis ATCC 23365 |
| 20 | 1704322 | 1704501 | - | NC_004310.3 | Brucella suis 1330 |
| 21 | 1710907 | 1711086 | - | NC_009505.1 | Brucella ovis ATCC 25840 |
| 22 | 1711849 | 1712028 | - | NC_013119.1 | Brucella microti CCM 4915 |
| 23 | 285032 | 285211 | + | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 24 | 282993 | 283172 | + | NC_022905.1 | Brucella ceti TE10759-12 |
| 25 | 1718396 | 1718575 | - | NC_007618.1 | Brucella abortus 2308 |
| 26 | 977183 | 977362 | + | NZ_LT605585.1 | Brucella inopinata |
| 27 | 5117600 | 5117782 | + | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 28 | 2029299 | 2029478 | - | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 29 | 3866389 | 3866574 | - | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 30 | 2888376 | 2888555 | + | NZ_CP042304.1 | Devosia ginsengisoli |
| 31 | 157708 | 157890 | + | NZ_CP017940.1 | Phyllobacterium zundukense |
| 32 | 27998 | 28183 | + | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 33 | 4167746 | 4167931 | + | NZ_CP020906.1 | Rhizobium etli |
| 34 | 2820031 | 2820216 | + | NZ_CP054021.1 | Rhizobium indicum |
| 35 | 4896510 | 4896695 | - | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 36 | 901368 | 901556 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 37 | 4413909 | 4414094 | - | NZ_CP032694.1 | Rhizobium jaguaris |
| 38 | 1393884 | 1394063 | - | NC_014932.1 | Bartonella clarridgeiae 73 |
| 39 | 3662575 | 3662760 | - | NZ_CP013107.1 | Sinorhizobium americanum |
| 40 | 4006527 | 4006712 | - | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 41 | 3670831 | 3671016 | - | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 42 | 1457450 | 1457632 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 43 | 5640436 | 5640618 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 44 | 1429190 | 1429372 | + | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 45 | 1443362 | 1443544 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 46 | 1402187 | 1402369 | + | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 47 | 3038943 | 3039125 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 48 | 2277578 | 2277760 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 49 | 340772 | 340954 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 50 | 3551740 | 3551925 | - | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 51 | 3235135 | 3235320 | - | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 52 | 3237173 | 3237358 | - | NZ_CP034909.1 | Ensifer alkalisoli |
| 53 | 4210121 | 4210306 | - | NZ_CP041238.1 | Ensifer mexicanus |
| 54 | 982186 | 982371 | + | NZ_CP032509.1 | Georhizobium profundi |
| 55 | 970144 | 970329 | + | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 56 | 1918734 | 1918922 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 57 | 108334 | 108519 | + | NZ_CP054027.1 | Rhizobium hidalgonense |
| 58 | 4010276 | 4010461 | - | NZ_CP034998.1 | Rhizobium acidisoli |
| 59 | 4238701 | 4238886 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 60 | 4341728 | 4341913 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 61 | 1685002 | 1685187 | + | NZ_CP071454.1 | Rhizobium lentis |
| 62 | 4398748 | 4398933 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 63 | 364449 | 364628 | - | NZ_CP010401.1 | Bartonella ancashensis |
| 64 | 4387649 | 4387834 | + | NZ_CP071604.1 | Rhizobium binae |
| 65 | 473145 | 473324 | + | NZ_CP009761.1 | Parvimonas micra |
| 66 | 2406832 | 2407014 | - | NZ_CP024201.1 | Caulobacter mirabilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016616.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13561.8 | 0.67 | 44 | 2645 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 2 | PF00106.27 | 0.71 | 47 | 2645.0 | same-strand | short chain dehydrogenase |
| 3 | PF08659.12 | 0.71 | 47 | 2645.0 | same-strand | KR domain |
| 4 | PF00108.25 | 0.65 | 43 | 1350 | same-strand | Thiolase, N-terminal domain |
| 5 | PF02803.20 | 0.65 | 43 | 1350 | same-strand | Thiolase, C-terminal domain |
| 6 | PF00912.24 | 0.71 | 47 | 214 | same-strand | Transglycosylase |
| 7 | PF00348.19 | 0.74 | 49 | 1128 | opposite-strand | Polyprenyl synthetase |
++ More..