Result : EXP00825
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00825 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1276179 |
| Right | 1276304 |
| Strand | - |
| Nucleotide Sequence | ATGAATTTGTTGATCACCGTACCGGGCGCTTTTTTATGCGCACGGAACTGGAAGGGATTTTTAATGATTCCACCCTGCTGGCGGATCTCGATAGCGCATTGCCAGAAGGCTCCGTGCGTGAGCTGA |
| Sequence | MNLLITVPGAFLCARNWKGFLMIPPCWRISIAHCQKAPCVS |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1733569 | 1733694 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1288387 | 1288512 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1283426 | 1283551 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2414086 | 2414211 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 758740 | 758865 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 2447885 | 2448034 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 1967509 | 1967625 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 8 | 2470757 | 2470882 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 9 | 1865530 | 1865646 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 10 | 429336 | 429461 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 11 | 1278951 | 1279067 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 12 | 3189160 | 3189285 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 13 | 2634311 | 2634427 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 14 | 1964891 | 1965016 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 15 | 1922623 | 1922748 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 16 | 2191346 | 2191471 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 17 | 1884745 | 1884894 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 18 | 2267950 | 2268066 | - | NZ_CP025799.1 | Dickeya zeae |
| 19 | 2435963 | 2436088 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 20 | 2664888 | 2665004 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 21 | 1450663 | 1450788 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 22 | 2863762 | 2863878 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 23 | 2332767 | 2332904 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 24 | 2628096 | 2628212 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 25 | 2641550 | 2641675 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 26 | 478415 | 478540 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 27 | 2126089 | 2126205 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 28 | 4479467 | 4479583 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 29 | 2097287 | 2097412 | - | NZ_CP054254.1 | Klebsiella variicola |
| 30 | 3943401 | 3943517 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 31 | 2243554 | 2243673 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 32 | 4627314 | 4627430 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 33 | 5026132 | 5026251 | + | NZ_CP026047.1 | Raoultella planticola |
| 34 | 3398436 | 3398561 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 35 | 2251423 | 2251542 | - | NZ_CP050508.1 | Raoultella terrigena |
| 36 | 2158328 | 2158447 | - | NZ_CP041247.1 | Raoultella electrica |
| 37 | 2532652 | 2532768 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 38 | 2085907 | 2086023 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 39 | 2004206 | 2004322 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 40 | 2463791 | 2463907 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 41 | 4362828 | 4362953 | + | NZ_CP053416.1 | Salmonella bongori |
| 42 | 2600898 | 2601014 | + | NC_015968.1 | Enterobacter soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02613.17 | 0.66 | 27 | 3169.5 | opposite-strand | Nitrate reductase delta subunit |
| 2 | PF02665.16 | 0.73 | 30 | 2648 | opposite-strand | Nitrate reductase gamma subunit |
| 3 | PF00551.21 | 1.0 | 41 | -122.0 | same-strand | Formyl transferase |
| 4 | PF01842.27 | 1.0 | 41 | -122.0 | same-strand | ACT domain |
| 5 | PF17775.3 | 1.0 | 41 | 162.5 | same-strand | UPF0225 domain |
| 6 | PF02810.17 | 1.0 | 41 | 162.5 | same-strand | SEC-C motif |
| 7 | PF01734.24 | 0.95 | 39 | 731.0 | opposite-strand | Patatin-like phospholipase |
| 8 | PF00072.26 | 1.0 | 41 | 1731.0 | opposite-strand | Response regulator receiver domain |
| 9 | PF00483.25 | 0.98 | 40 | 2945 | opposite-strand | Nucleotidyl transferase |
++ More..