Result : B1ZTJ1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP001032.1 |
| Organism | Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) |
| Left | 792448 |
| Right | 792708 |
| Strand | - |
| Nucleotide Sequence | ATGGCCAACACGAAATCTGCGATCAAAGCCGCCCGTAAGTCTCTGCGTCTCCATGACCGGAACCAAGGCGTGAAAACCCGCCTGAAGACGCTGCACAAGAAGCTTGAGACGGCGGTCAAGAGCGGTGACGCGGCCAGCAGCAAGGCGGCGGCGGTCGCCTACACCTCCGCGGTCGACAAGGCCGTGAAGTCGGGCGTGGTGCATCGCAACGTCGCTGCTCGCGCCAAGTCGCACGTCGCGAAGATCGTCTTCGCGAAGTAA |
| Sequence | MANTKSAIKAARKSLRLHDRNQGVKTRLKTLHKKLETAVKSGDAASSKAAAVAYTSAVDKAVKSGVVHRNVAARAKSHVAKIVFAK |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 21398538 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1ZTJ1 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 792448 | 792708 | - | NC_010571.1 | Opitutus terrae PB90-1 |
| 2 | 2015212 | 2015475 | + | NZ_CP016094.1 | Lacunisphaera limnophila |
| 3 | 2833814 | 2834074 | + | NZ_CP023344.1 | Nibricoccus aquaticus |
| 4 | 2786480 | 2786737 | + | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010571.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08213.13 | 1.0 | 4 | 6231.0 | same-strand | Mitochondrial domain of unknown function (DUF1713) |
++ More..