Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00814 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 4389040 |
Right | 4389135 |
Strand | - |
Nucleotide Sequence | GTGCTGACTTTATCTATACCGATGTATGGGTGTCGATGGGTGAAGCAAAAGAGAAATGGGCTGAACGCATTGCATTGCTGCGTGATTATCAAGTGA |
Sequence | VLTLSIPMYGCRWVKQKRNGLNALHCCVIIK |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 31 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5333167 | 5333262 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 4409831 | 4409926 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 3981778 | 3981873 | + | NZ_CP061527.1 | Shigella dysenteriae |
4 | 4477543 | 4477638 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
5 | 513470 | 513556 | - | NZ_LR134340.1 | Escherichia marmotae |
6 | 552392 | 552487 | - | NZ_CP009756.1 | Enterobacter cloacae |
7 | 4522226 | 4522321 | - | NZ_AP014857.1 | Escherichia albertii |
8 | 3067454 | 3067549 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
9 | 1170404 | 1170511 | - | NZ_CP045205.1 | Citrobacter telavivensis |
10 | 3302669 | 3302776 | - | NZ_CP033744.1 | Citrobacter freundii |
11 | 4711989 | 4712075 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
12 | 2804176 | 2804283 | + | NZ_CP038469.1 | Citrobacter tructae |
13 | 504439 | 504525 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
14 | 2893781 | 2893861 | + | NZ_CP045350.1 | Vibrio aquimaris |
15 | 3389350 | 3389445 | - | NZ_CP049115.1 | Pantoea stewartii |
16 | 427381 | 427494 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
17 | 3888601 | 3888696 | + | NZ_CP048796.1 | Providencia vermicola |
18 | 555124 | 555204 | - | NZ_AP023184.1 | Buttiauxella agrestis |
19 | 805888 | 805965 | + | NZ_LR134531.1 | Pragia fontium |
20 | 3950348 | 3950434 | + | NZ_CP042220.2 | Dickeya poaceiphila |
21 | 907729 | 907830 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
22 | 1009466 | 1009567 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
23 | 1467443 | 1467544 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
24 | 742517 | 742603 | + | NZ_CP022437.1 | Virgibacillus necropolis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00185.26 | 0.96 | 22 | -90.5 | same-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
2 | PF02729.23 | 0.96 | 22 | -90.5 | same-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
3 | PF06877.13 | 0.78 | 18 | 837 | opposite-strand | Regulator of ribonuclease activity B |
4 | PF00583.27 | 0.61 | 14 | 1597 | same-strand | Acetyltransferase (GNAT) family |
5 | PF13508.9 | 0.61 | 14 | 1835.5 | same-strand | Acetyltransferase (GNAT) domain |
6 | PF13302.9 | 0.61 | 14 | 1597 | same-strand | Acetyltransferase (GNAT) domain |