Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | CP001032.1 |
Organism | Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) |
Left | 3049792 |
Right | 3050076 |
Strand | + |
Nucleotide Sequence | ATGGCCACCGACCTCAACATCGATCACGTCGCGAATCTTGCGCGGCTCGCGCTCACGCCGGAGGAGAAGGCGACCTTCGCCCAACAACTCGGCGACGTGCTGCACCACATCGAGCAACTCGCGAAAGTCGACGTCGCCGGCGTCGAGCCGACGGCGCATGCGTTTGCGGTGACGAATGTCTGGGCCGACGACGCGCCGCAACCAGGGTTATCCGTCGAAGCCGCGCTCAAGAACGCCCCGGCGCAGCGCGAGCACATGGTCGTCGTGCCCAAGGTGGTGGAGTGA |
Sequence | MATDLNIDHVANLARLALTPEEKATFAQQLGDVLHHIEQLAKVDVAGVEPTAHAFAVTNVWADDAPQPGLSVEAALKNAPAQREHMVVVPKVVE |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | 21398538 |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | B1ZQN2 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3049792 | 3050076 | + | NC_010571.1 | Opitutus terrae PB90-1 |
2 | 302273 | 302563 | - | NZ_CP023344.1 | Nibricoccus aquaticus |
3 | 4032523 | 4032780 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
4 | 1755276 | 1755536 | - | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00453.20 | 0.75 | 3 | 4341 | same-strand | Ribosomal protein L20 |
2 | PF01409.22 | 1.0 | 4 | 3433.0 | same-strand | tRNA synthetases class II core domain (F) |
3 | PF02912.20 | 1.0 | 4 | 3433.0 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
4 | PF03483.19 | 1.0 | 4 | 676.0 | same-strand | B3/4 domain |
5 | PF03147.16 | 1.0 | 4 | 676.0 | same-strand | Ferredoxin-fold anticodon binding domain |
6 | PF01588.22 | 1.0 | 4 | 676.0 | same-strand | Putative tRNA binding domain |
7 | PF03484.17 | 1.0 | 4 | 676.0 | same-strand | tRNA synthetase B5 domain |
8 | PF01425.23 | 1.0 | 4 | 64.5 | same-strand | Amidase |
9 | PF02934.17 | 1.0 | 4 | 1622.5 | same-strand | GatB/GatE catalytic domain |
10 | PF02637.20 | 1.0 | 4 | 1622.5 | same-strand | GatB domain |