Result : EXP00797
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00797 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2254875 |
| Right | 2255111 |
| Strand | - |
| Nucleotide Sequence | ATTCAAATCATAATGCACCAGATCTTCAGGTTTTACCCACGCGTAGTCCTGAAACTCTTCGTTTATTTTCACTTCTCGGTTGGCAGAAACGCAGTCAAAAATCAGGTAAATCATATAAATCTCTTCCTTGCGACCATCTGCATACGTCTTGGTGCGAATATCATCGCTGAAGGTCCACGGCGTGATTTCTGTCAAAAGCAGCTGTTCTCCCAGTTCTTCGCGAATTTCGCGGCGTAG |
| Sequence | IQIIMHQIFRFYPRVVLKLFVYFHFSVGRNAVKNQVNHINLFLATICIRLGANIIAEGPRRDFCQKQLFSQFFANFAA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2364701 | 2364925 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2377430 | 2377654 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3095349 | 3095573 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 181213 | 181425 | + | NZ_CP038469.1 | Citrobacter tructae |
| 5 | 4675294 | 4675560 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 6 | 376244 | 376453 | - | NZ_CP053416.1 | Salmonella bongori |
| 7 | 150627 | 150839 | - | NZ_CP026047.1 | Raoultella planticola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00994.26 | 1.0 | 6 | 1068 | same-strand | Probable molybdopterin binding domain |
| 2 | PF07437.13 | 1.0 | 6 | 426 | same-strand | YfaZ precursor |
| 3 | PF00293.30 | 1.0 | 6 | -224 | opposite-strand | NUDIX domain |
| 4 | PF14815.8 | 1.0 | 6 | -224 | opposite-strand | NUDIX domain |
| 5 | PF01041.19 | 0.67 | 4 | 985 | opposite-strand | DegT/DnrJ/EryC1/StrS aminotransferase family |
| 6 | PF00535.28 | 0.67 | 4 | 2146 | opposite-strand | Glycosyl transferase family 2 |
| 7 | PF01370.23 | 0.67 | 4 | 3114 | opposite-strand | NAD dependent epimerase/dehydratase family |
| 8 | PF16363.7 | 0.67 | 4 | 3114 | opposite-strand | GDP-mannose 4,6 dehydratase |
| 9 | PF02911.20 | 0.67 | 4 | 3114 | opposite-strand | Formyl transferase, C-terminal domain |
| 10 | PF01522.23 | 0.67 | 4 | 5092 | opposite-strand | Polysaccharide deacetylase |
++ More..