Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L23 |
NCBI Accession ID | CP001032.1 |
Organism | Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) |
Left | 250645 |
Right | 250926 |
Strand | - |
Nucleotide Sequence | ATGCAAGCCGACCAGGTTCTCAAACTCGTCCGCCTCTCGGAGAAGTCCAACAAGCTTTCGTCCGAGCTCGGCCAATACACCTTCGAGGTGTTCAAGGGCACGAACAAGCACCAGATCGCCGAGGCCGTGGAGCAGACCTTCAAGGTCACGGTCAAGCGCGTGAACGTGCAGAATTACCGCGGCAAAAACAAAAAAAGCCGCACCGGCCGCCCGAGCGTCGGTTCCGACTACAAGAAGGCAATCGTGACGCTTAAAGCCGGCGACAAGATCGAACTCGTCTAA |
Sequence | MQADQVLKLVRLSEKSNKLSSELGQYTFEVFKGTNKHQIAEAVEQTFKVTVKRVNVQNYRGKNKKSRTGRPSVGSDYKKAIVTLKAGDKIELV |
Source of smORF | Swiss-Prot |
Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
Pubmed ID | 21398538 |
Domain | CDD:412311 |
Functional Category | Ribosomal_protein |
Uniprot ID | B1ZNE6 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 250645 | 250926 | - | NC_010571.1 | Opitutus terrae PB90-1 |
2 | 1279658 | 1279939 | - | NZ_CP023344.1 | Nibricoccus aquaticus |
3 | 528497 | 528784 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
4 | 2064214 | 2064504 | - | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
5 | 1076058 | 1076342 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
6 | 5726953 | 5727225 | + | NZ_CP023690.1 | Streptomyces spectabilis |
7 | 2071902 | 2072138 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
8 | 240107 | 240394 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
9 | 463179 | 463466 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
10 | 1537855 | 1538091 | - | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
11 | 1171430 | 1171657 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
12 | 2492862 | 2493134 | - | NZ_CP033081.1 | Glutamicibacter nicotianae |
13 | 5535098 | 5535358 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
14 | 439341 | 439595 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
15 | 470981 | 471235 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
16 | 8754183 | 8754482 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
17 | 3495656 | 3495919 | + | NZ_CP016793.1 | Lentzea guizhouensis |
18 | 4691399 | 4691668 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
19 | 3542366 | 3542626 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
20 | 558121 | 558351 | + | NZ_CP046996.1 | Dehalobacter restrictus |
21 | 354699 | 354935 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
22 | 2256120 | 2256356 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
23 | 4558152 | 4558415 | - | NZ_CP022752.1 | Actinopolyspora erythraea |
24 | 2853641 | 2853904 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00252.20 | 0.96 | 23 | 2302 | same-strand | Ribosomal protein L16p/L10e |
2 | PF00189.22 | 1.0 | 24 | 1574.5 | same-strand | Ribosomal protein S3, C-terminal domain |
3 | PF07650.19 | 1.0 | 24 | 1574.5 | same-strand | KH domain |
4 | PF00237.21 | 1.0 | 24 | 1184.5 | same-strand | Ribosomal protein L22p/L17e |
5 | PF00203.23 | 1.0 | 24 | 884.5 | same-strand | Ribosomal protein S19 |
6 | PF03947.20 | 1.0 | 24 | 27.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
7 | PF00181.25 | 1.0 | 24 | 27.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
8 | PF00573.24 | 1.0 | 24 | 33.0 | same-strand | Ribosomal protein L4/L1 family |
9 | PF00338.24 | 0.96 | 23 | 1402 | same-strand | Ribosomal protein S10p/S20e |
10 | PF00009.29 | 0.79 | 19 | 2296.5 | same-strand | Elongation factor Tu GTP binding domain |
11 | PF03764.20 | 0.71 | 17 | 3298 | same-strand | Elongation factor G, domain IV |
12 | PF14492.8 | 0.71 | 17 | 3298 | same-strand | Elongation Factor G, domain III |
13 | PF00679.26 | 0.71 | 17 | 3298 | same-strand | Elongation factor G C-terminus |
14 | PF03144.27 | 0.75 | 18 | 2293 | same-strand | Elongation factor Tu domain 2 |
15 | PF03143.19 | 0.62 | 15 | 2092 | same-strand | Elongation factor Tu C-terminal domain |