Result : EXP00794
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00794 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1345543 |
| Right | 1345710 |
| Strand | - |
| Nucleotide Sequence | ATGATGCCGATGATTAAATCCCCGCATGGCGAGGGAGGCTGCGTATGCGCCCCTCCTGCGACTGACTGGACTCCGCCCCCTTTGCTTCCCTTGCTAAACAGGTTTGATTTCAGGTCGACACGACCGCAAACCTTATTACGCAGGGGAGGCAGCAATTATGGCTATTAA |
| Sequence | MMPMIKSPHGEGGCVCAPPATDWTPPPLLPLLNRFDFRSTRPQTLLRRGGSNYGY |
| Source of smORF | Ribo-seq |
| Function | INDUCTION: Expressed approximately equally in exponential and stationary phases (at protein level) Pubmed:29645342 |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DPO2 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1359177 | 1359344 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1353449 | 1353616 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1830453 | 1830620 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 1867247 | 1867414 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1422559 | 1422726 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 387088 | 387264 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00528.24 | 0.6 | 3 | 3725 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 2 | PF00496.24 | 0.6 | 3 | 2067.0 | same-strand | Bacterial extracellular solute-binding proteins, family 5 Middle |
| 3 | PF10820.10 | 0.6 | 3 | 1509.0 | same-strand | Protein of unknown function (DUF2543) |
| 4 | PF00324.23 | 0.8 | 4 | -10 | same-strand | Amino acid permease |
| 5 | PF13520.8 | 0.8 | 4 | -10 | same-strand | Amino acid permease |
| 6 | PF00120.26 | 1.0 | 5 | 146.0 | same-strand | Glutamine synthetase, catalytic domain |
| 7 | PF07722.15 | 0.8 | 4 | 1779 | opposite-strand | Peptidase C26 |
| 8 | PF07883.13 | 1.0 | 5 | 2567.0 | opposite-strand | Cupin domain |
| 9 | PF01381.24 | 1.0 | 5 | 2567.0 | opposite-strand | Helix-turn-helix |
| 10 | PF13560.8 | 1.0 | 5 | 2567.0 | opposite-strand | Helix-turn-helix domain |
| 11 | PF12844.9 | 1.0 | 5 | 2567.0 | opposite-strand | Helix-turn-helix domain |
| 12 | PF00171.24 | 0.8 | 4 | 3276 | opposite-strand | Aldehyde dehydrogenase family |
| 13 | PF01266.26 | 0.8 | 4 | 4765 | opposite-strand | FAD dependent oxidoreductase |
++ More..