Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00792 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 4390280 |
Right | 4390390 |
Strand | + |
Nucleotide Sequence | TTGACGTTGAGTACGACGGTTGGGGCACTTACTTTGAAGATCCCAACGGCGAAGATGGCGACGATGAAGATTTTGTCGATGAAGACGATGACGGGGTTCGCCACTAATTAA |
Sequence | LTLSTTVGALTLKIPTAKMATMKILSMKTMTGFATN |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 36 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5334407 | 5334517 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 3980523 | 3980633 | - | NZ_CP061527.1 | Shigella dysenteriae |
3 | 4408576 | 4408680 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 4478783 | 4478893 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
5 | 514727 | 514831 | + | NZ_LR134340.1 | Escherichia marmotae |
6 | 4523473 | 4523577 | + | NZ_AP014857.1 | Escherichia albertii |
7 | 2287373 | 2287480 | + | NZ_CP026047.1 | Raoultella planticola |
8 | 4738252 | 4738359 | - | NZ_CP041247.1 | Raoultella electrica |
9 | 5019654 | 5019761 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
10 | 4680715 | 4680843 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04074.14 | 0.89 | 8 | 1624 | same-strand | YhcH/YjgK/YiaL |
2 | PF00185.26 | 1.0 | 9 | 486 | opposite-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
3 | PF02729.23 | 1.0 | 9 | 486 | opposite-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
4 | PF06877.13 | 1.0 | 9 | -103.0 | same-strand | Regulator of ribonuclease activity B |
5 | PF00583.27 | 1.0 | 9 | 157.0 | opposite-strand | Acetyltransferase (GNAT) family |
6 | PF13508.9 | 1.0 | 9 | 157.0 | opposite-strand | Acetyltransferase (GNAT) domain |
7 | PF13302.9 | 1.0 | 9 | 157.0 | opposite-strand | Acetyltransferase (GNAT) domain |
8 | PF00133.24 | 0.89 | 8 | 1972 | opposite-strand | tRNA synthetases class I (I, L, M and V) |
9 | PF08264.15 | 0.89 | 8 | 1972 | opposite-strand | Anticodon-binding domain of tRNA ligase |
10 | PF10458.11 | 0.89 | 8 | 1972 | opposite-strand | Valyl tRNA synthetase tRNA binding arm |
11 | PF04364.15 | 0.89 | 8 | 4827 | opposite-strand | DNA polymerase III chi subunit, HolC |
12 | PF00883.23 | 0.89 | 8 | 5420 | opposite-strand | Cytosol aminopeptidase family, catalytic domain |
13 | PF02789.19 | 0.89 | 8 | 5420 | opposite-strand | Cytosol aminopeptidase family, N-terminal domain |