Result : EXP00784
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00784 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2458903 |
| Right | 2459100 |
| Strand | + |
| Nucleotide Sequence | TTGCAAAGCACCAGCAATAAGTTGCCGCCCTGTGCCTTCCCGCTGACGAGCCGGATGAACTGCTATCCGGCTGACCCGCCGTCCACGCAATGTCGCCGCCAGTGGATTGTTGCCGTGCGCCGCCAGCGACTGGGCCACCAGATTACCCCGCGGGCGACGAAAACCTGCCCATACCGCCTGACTGAGTTGTTGAGATAA |
| Sequence | LQSTSNKLPPCAFPLTSRMNCYPADPPSTQCRRQWIVAVRRQRLGHQITPRATKTCPYRLTELLR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2594414 | 2594611 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1153506 | 1153703 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 2582471 | 2582668 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3310644 | 3310841 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2561458 | 2561631 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 4245533 | 4245706 | - | NZ_CP057657.1 | Escherichia fergusonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03960.17 | 0.8 | 4 | 2811 | same-strand | ArsC family |
| 2 | PF01546.30 | 0.8 | 4 | 1680 | same-strand | Peptidase family M20/M25/M40 |
| 3 | PF07687.16 | 0.8 | 4 | 1680 | same-strand | Peptidase dimerisation domain |
| 4 | PF13980.8 | 1.0 | 5 | 1455.5 | same-strand | Uncharacterised protein family (UPF0370) |
| 5 | PF02230.18 | 0.8 | 4 | 644 | opposite-strand | Phospholipase/Carboxylesterase |
| 6 | PF05127.16 | 1.0 | 5 | -197.0 | opposite-strand | Helicase |
| 7 | PF17176.6 | 1.0 | 5 | -197.0 | opposite-strand | tRNA-binding domain |
| 8 | PF08351.13 | 1.0 | 5 | -197.0 | opposite-strand | Domain of unknown function (DUF1726) |
| 9 | PF04228.15 | 0.8 | 4 | 1263 | opposite-strand | Putative neutral zinc metallopeptidase |
| 10 | PF01259.20 | 1.0 | 5 | 2294.0 | opposite-strand | SAICAR synthetase |
| 11 | PF06804.13 | 0.8 | 4 | 3220 | opposite-strand | NlpB/DapX lipoprotein |
| 12 | PF00701.24 | 0.8 | 4 | 4271 | opposite-strand | Dihydrodipicolinate synthetase family |
++ More..