Result : EXP00771
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00771 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 4083496 |
| Right | 4083630 |
| Strand | + |
| Nucleotide Sequence | ATTCCGGTAGTCGGCACCATCAAGTCCGGTGGGGTTCCCGAGCGGCCAAAGGGAGCAGACTGTAAATCTGCCGTCACAGACTTCGAAGGTTCGAATCCTTCCCCCACCACCAATTTCGGCCACGCGATGGCGTAG |
| Sequence | IPVVGTIKSGGVPERPKGADCKSAVTDFEGSNPSPTTNFGHAMA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1885173 | 1885310 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 2 | 268240 | 268365 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 3 | 5501877 | 5502020 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 4 | 1186451 | 1186582 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 5 | 3168887 | 3169018 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 6 | 4199953 | 4200084 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 7 | 2122091 | 2122204 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 8 | 2196163 | 2196291 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 9 | 966515 | 966646 | + | NZ_CP029736.1 | Providencia rettgeri |
| 10 | 4060206 | 4060334 | - | NZ_CP007230.1 | Yersinia similis |
| 11 | 4110047 | 4110181 | - | NZ_LS483422.1 | Providencia heimbachae |
| 12 | 131349 | 131471 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 13 | 6141968 | 6142102 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 14 | 668896 | 669033 | + | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 15 | 280350 | 280484 | + | NZ_CP028897.1 | Dongshaea marina |
| 16 | 3612025 | 3612159 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 17 | 4533584 | 4533715 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 18 | 1902313 | 1902450 | - | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 19 | 2378997 | 2379125 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 20 | 2358795 | 2358938 | - | NZ_AP014879.1 | Sulfuricaulis limicola |
| 21 | 408438 | 408563 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 22 | 1603704 | 1603826 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 23 | 547589 | 547717 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 24 | 2339067 | 2339195 | - | NZ_CP020472.1 | Shewanella japonica |
| 25 | 486109 | 486231 | + | NZ_CP043998.1 | Clostridium diolis |
| 26 | 618310 | 618450 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 27 | 3118613 | 3118723 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 28 | 3255326 | 3255460 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 29 | 1532049 | 1532159 | - | NZ_AP012333.1 | Parascardovia denticolens DSM 10105 = JCM 12538 |
| 30 | 2481285 | 2481398 | - | NZ_CP014646.1 | Thauera humireducens |
| 31 | 1553100 | 1553258 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 32 | 2774337 | 2774447 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 33 | 638966 | 639082 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 34 | 430703 | 430843 | + | NZ_CP013979.1 | Agromyces aureus |
| 35 | 169292 | 169414 | + | NZ_CP012024.1 | Bacillus smithii |
| 36 | 622142 | 622252 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 37 | 436130 | 436252 | + | NZ_CP022544.1 | Bifidobacterium pseudolongum |
++ More..