Result : EXP00770
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00770 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 978643 |
| Right | 978861 |
| Strand | + |
| Nucleotide Sequence | TTGATGATATTGCGGAAAAGTTTTCCCGTAACATTTACGGCACCACCAAAGGGCAGCTTCGACAGGCTATTCTGTGGCAGGATCTCGATCGCGTGCTGGCGGAAATGGGCCCGCAAAAACTGCGTGTGCTGGATGCTGGCGGTGGAGAAGGGCAGACCGCAATCAAAATGGCCGAGCGTGGGCATCAGGTCATTTTATGCGATCTTTCTGCGCAGATGA |
| Sequence | LMILRKSFPVTFTAPPKGSFDRLFCGRISIACWRKWARKNCVCWMLAVEKGRPQSKWPSVGIRSFYAIFLRR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 973553 | 973771 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 47565 | 47783 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 1103196 | 1103414 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 957338 | 957556 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1473816 | 1474034 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 1087668 | 1087886 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 7 | 1989882 | 1990100 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 1077425 | 1077616 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 1697822 | 1698013 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 10 | 2973972 | 2974160 | - | NZ_CP045845.1 | Kluyvera intermedia |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03966.18 | 1.0 | 9 | 2698.0 | same-strand | Trm112p-like protein |
| 2 | PF02348.21 | 1.0 | 9 | 1955.0 | same-strand | Cytidylyltransferase |
| 3 | PF02698.19 | 1.0 | 9 | 152.0 | opposite-strand | DUF218 domain |
| 4 | PF13847.8 | 0.89 | 8 | -218 | same-strand | Methyltransferase domain |
| 5 | PF13649.8 | 1.0 | 9 | -218.0 | same-strand | Methyltransferase domain |
| 6 | PF08241.14 | 1.0 | 9 | -218.0 | same-strand | Methyltransferase domain |
| 7 | PF08242.14 | 1.0 | 9 | -218.0 | same-strand | Methyltransferase domain |
| 8 | PF17192.6 | 1.0 | 9 | 548.5 | same-strand | MukF middle domain |
| 9 | PF17193.6 | 1.0 | 9 | 548.5 | same-strand | MukF C-terminal domain |
| 10 | PF03882.16 | 1.0 | 9 | 548.5 | same-strand | MukF winged-helix domain |
| 11 | PF04288.15 | 1.0 | 9 | 1851.5 | same-strand | MukE-like family |
| 12 | PF04310.14 | 1.0 | 9 | 2555.5 | same-strand | MukB N-terminal |
| 13 | PF16330.7 | 1.0 | 9 | 2555.5 | same-strand | MukB hinge domain |
| 14 | PF13558.8 | 1.0 | 9 | 2555.5 | same-strand | Putative exonuclease SbcCD, C subunit |
| 15 | PF03734.16 | 0.89 | 8 | 7276 | same-strand | L,D-transpeptidase catalytic domain |
| 16 | PF20142.1 | 0.89 | 8 | 7276 | same-strand | Scaffold domain |
| 17 | PF13489.8 | 0.67 | 6 | -204.5 | same-strand | Methyltransferase domain |
++ More..