Result : EXP00766
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00766 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2332899 |
| Right | 2333093 |
| Strand | + |
| Nucleotide Sequence | TTGGAGGTTCAAACCAGCTTTGCAGTTCTGCCCCGCAACCATCGCCTGATGGCGGTAAAGGTTGATCTTCACACTCCAGACTATCGGCAGGGCAACGTAATCGTACATGCATATGCGCGCGATGCTGGAACCAGGGTCGCACTTTGCGCAACCAGTCGCGATCGGTGCCCGCATCAAGGCAAAGTTGTTGTTTAA |
| Sequence | LEVQTSFAVLPRNHRLMAVKVDLHTPDYRQGNVIVHAYARDAGTRVALCATSRDRCPHQGKVVV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2453768 | 2453962 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 2445646 | 2445840 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1279954 | 1280148 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3172143 | 3172337 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 4352977 | 4353171 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 2447205 | 2447399 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 2989858 | 2990052 | + | NZ_LR134340.1 | Escherichia marmotae |
| 8 | 2891957 | 2892184 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 456208 | 456402 | + | NZ_CP053416.1 | Salmonella bongori |
| 10 | 439079 | 439285 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 11 | 4608166 | 4608375 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 12 | 2169111 | 2169332 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 13 | 3425941 | 3426135 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 14 | 4690154 | 4690375 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 15 | 4670372 | 4670581 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 16 | 3370562 | 3370771 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 17 | 2493798 | 2493992 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 18 | 1692300 | 1692491 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 19 | 3315191 | 3315385 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 20 | 1643641 | 1643850 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 21 | 3286794 | 3286988 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 22 | 3310543 | 3310737 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 23 | 232201 | 232395 | + | NZ_CP026047.1 | Raoultella planticola |
| 24 | 3594828 | 3595022 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 25 | 3534291 | 3534500 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 26 | 1457136 | 1457327 | - | NZ_CP041247.1 | Raoultella electrica |
| 27 | 3272968 | 3273162 | + | NC_015968.1 | Enterobacter soli |
| 28 | 1468482 | 1468673 | - | NZ_CP054254.1 | Klebsiella variicola |
| 29 | 3934104 | 3934298 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 30 | 3972545 | 3972739 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 31 | 1133508 | 1133702 | + | NZ_CP033744.1 | Citrobacter freundii |
| 32 | 29278 | 29472 | - | NZ_CP038469.1 | Citrobacter tructae |
| 33 | 1446627 | 1446821 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 34 | 4718250 | 4718444 | + | NZ_CP007230.1 | Yersinia similis |
| 35 | 1513634 | 1513840 | - | NZ_CP050508.1 | Raoultella terrigena |
| 36 | 1282878 | 1283075 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05430.13 | 0.97 | 34 | 1827 | same-strand | S-adenosyl-L-methionine-dependent methyltransferase |
| 2 | PF01266.26 | 0.97 | 34 | 1827 | same-strand | FAD dependent oxidoreductase |
| 3 | PF08891.13 | 1.0 | 35 | 1475.0 | opposite-strand | YfcL protein |
| 4 | PF04315.14 | 1.0 | 35 | 895.0 | opposite-strand | Elongation factor P hydroxylase |
| 5 | PF01925.21 | 1.0 | 35 | 86.0 | opposite-strand | Sulfite exporter TauE/SafE |
| 6 | PF03411.15 | 1.0 | 35 | -194.0 | opposite-strand | Penicillin-insensitive murein endopeptidase |
| 7 | PF01264.23 | 1.0 | 35 | 548.0 | opposite-strand | Chorismate synthase |
| 8 | PF13649.8 | 1.0 | 35 | 1670.5 | opposite-strand | Methyltransferase domain |
| 9 | PF01713.23 | 1.0 | 35 | 2769.5 | same-strand | Smr domain |
++ More..