Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L24 |
NCBI Accession ID | CP001032.1 |
Organism | Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) |
Left | 246490 |
Right | 246768 |
Strand | - |
Nucleotide Sequence | ATGGCTCAGAAATTTCACGTCAAACGCGGCGACCAGGTCGTCGTCATCGCCGGCTCCCAAAAGGGCAAGTCGGGCAAGGTCCTCGAGGTCCTCGCGGCCAAGCAGCGCGCGCGCATCGAAGGCGTGGCCATGATCAAGCGCCACCTCAAGAAGTCGCAGGAGCACCCGCAGGGCACGATTGCCGAGCGCGAAGGTTCGGTGCACATCTCGAACCTGATGCTCCAGTCGACGTTCGACGCCAGCAAGCGGAAGAAGGAAGCCGCGCCGGCCAAGGCCTGA |
Sequence | MAQKFHVKRGDQVVVIAGSQKGKSGKVLEVLAAKQRARIEGVAMIKRHLKKSQEHPQGTIAEREGSVHISNLMLQSTFDASKRKKEAAPAKA |
Source of smORF | Swiss-Prot |
Function | One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit. {ECO:0000255|HAMAP-Rule:MF_01326}.; One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit. {ECO:0000255|HAMAP-Rule:MF_01326}. |
Pubmed ID | 21398538 |
Domain | CDD:412330,CDD:128978 |
Functional Category | Ribosomal_protein |
Uniprot ID | B1ZND7 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 246490 | 246768 | - | NC_010571.1 | Opitutus terrae PB90-1 |
2 | 1275681 | 1275947 | - | NZ_CP023344.1 | Nibricoccus aquaticus |
3 | 524572 | 524853 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00861.24 | 1.0 | 3 | 2147 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
2 | PF00347.25 | 1.0 | 3 | 1506 | same-strand | Ribosomal protein L6 |
3 | PF00410.21 | 1.0 | 3 | 1095 | same-strand | Ribosomal protein S8 |
4 | PF00253.23 | 1.0 | 3 | 730 | same-strand | Ribosomal protein S14p/S29e |
5 | PF00673.23 | 1.0 | 3 | 130 | same-strand | ribosomal L5P family C-terminus |
6 | PF00281.21 | 1.0 | 3 | 130 | same-strand | Ribosomal protein L5 |
7 | PF00238.21 | 1.0 | 3 | 2 | same-strand | Ribosomal protein L14p/L23e |
8 | PF00366.22 | 1.0 | 3 | 391 | same-strand | Ribosomal protein S17 |
9 | PF00831.25 | 1.0 | 3 | 762 | same-strand | Ribosomal L29 protein |
10 | PF00252.20 | 1.0 | 3 | 987 | same-strand | Ribosomal protein L16p/L10e |
11 | PF00189.22 | 1.0 | 3 | 1452 | same-strand | Ribosomal protein S3, C-terminal domain |
12 | PF07650.19 | 1.0 | 3 | 1452 | same-strand | KH domain |