Result : EXP00760
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00760 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3873034 |
| Right | 3873171 |
| Strand | + |
| Nucleotide Sequence | ATCCTCTCTCGCCGACCAATTTTGAACCCCGCTTCGGCGGGGTTTTTTGTTTTCTGTGCATTTCGTCACTTTCCCTTCGCAATAAACGCCCGTAATAACGCATTGCGCCACGGTATGATTTCGCCCTTAACTTATTGA |
| Sequence | ILSRRPILNPASAGFFVFCAFRHFPFAINARNNALRHGMISPLTY |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4776573 | 4776689 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3982815 | 3982931 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3991378 | 3991494 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 4363987 | 4364103 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 4312956 | 4313072 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 2792200 | 2792316 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 1620061 | 1620189 | + | NZ_CP013401.1 | Burkholderia metallica |
| 8 | 1615869 | 1615997 | + | NZ_CP013398.1 | Burkholderia seminalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07429.13 | 0.71 | 5 | 4211.0 | same-strand | 4-alpha-L-fucosyltransferase glycosyl transferase group 56 |
| 2 | PF06899.13 | 0.71 | 5 | 2862.0 | same-strand | WzyE protein, O-antigen assembly polymerase |
| 3 | PF03808.15 | 0.71 | 5 | 2119.0 | same-strand | Glycosyl transferase WecG/TagA/CpsF family |
| 4 | PF00324.23 | 0.71 | 5 | 543.0 | same-strand | Amino acid permease |
| 5 | PF13520.8 | 0.71 | 5 | 543.0 | same-strand | Amino acid permease |
| 6 | PF13186.8 | 0.71 | 5 | 27.0 | same-strand | Iron-sulfur cluster-binding domain |
++ More..