Result : EXP00758
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00758 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3928873 |
| Right | 3928974 |
| Strand | + |
| Nucleotide Sequence | TTGGCAGTTATTGATTATTGCCGTCATCGTTGTACTGCTTTTTGGCACCAAAAAGCTCGGCTCCATCGGTTCCGATCTTGGTGCGTCGATCAAAGGCTTTAA |
| Sequence | LAVIDYCRHRCTAFWHQKARLHRFRSWCVDQRL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4818398 | 4818499 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4021962 | 4022063 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4035101 | 4035202 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 4312806 | 4312907 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 4355074 | 4355175 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 3992463 | 3992564 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 2734355 | 2734456 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 2296343 | 2296459 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 9 | 2794175 | 2794267 | + | NZ_CP033744.1 | Citrobacter freundii |
| 10 | 170299 | 170391 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 11 | 1083059 | 1083175 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 12 | 591156 | 591272 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 13 | 4137011 | 4137130 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 14 | 1984527 | 1984628 | + | NZ_CP053416.1 | Salmonella bongori |
| 15 | 3308108 | 3308221 | - | NZ_CP038469.1 | Citrobacter tructae |
| 16 | 4180534 | 4180635 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 17 | 4334965 | 4335066 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 18 | 5918944 | 5919045 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 19 | 214527 | 214628 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 20 | 237835 | 237954 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 21 | 5302530 | 5302631 | - | NZ_CP054254.1 | Klebsiella variicola |
| 22 | 5552760 | 5552861 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 23 | 5861259 | 5861360 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02646.18 | 0.91 | 20 | 3202 | same-strand | RmuC family |
| 2 | PF01209.20 | 1.0 | 22 | 2352 | same-strand | ubiE/COQ5 methyltransferase family |
| 3 | PF13649.8 | 1.0 | 22 | 2352 | same-strand | Methyltransferase domain |
| 4 | PF08241.14 | 1.0 | 22 | 2352 | same-strand | Methyltransferase domain |
| 5 | PF13847.8 | 1.0 | 22 | 2352 | same-strand | Methyltransferase domain |
| 6 | PF13489.8 | 1.0 | 22 | 2352 | same-strand | Methyltransferase domain |
| 7 | PF08242.14 | 1.0 | 22 | 2352 | same-strand | Methyltransferase domain |
| 8 | PF02036.19 | 1.0 | 22 | 1733 | same-strand | SCP-2 sterol transfer family |
| 9 | PF03109.18 | 1.0 | 22 | 96 | same-strand | ABC1 atypical kinase-like domain |
| 10 | PF02416.18 | 1.0 | 22 | -101 | same-strand | mttA/Hcf106 family |
| 11 | PF00902.20 | 1.0 | 22 | 673 | same-strand | Sec-independent protein translocase protein (TatC) |
| 12 | PF01026.23 | 0.95 | 21 | 1497.5 | same-strand | TatD related DNase |
| 13 | PF02357.21 | 1.0 | 22 | 2286 | opposite-strand | Transcription termination factor nusG |
++ More..