Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00756 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 2781452 |
Right | 2781577 |
Strand | + |
Nucleotide Sequence | ATCTTAATAGTATTGATTAACAGGCTAAAATTAACGCCTAACACTATTCAGCATATGTTACTGACGCGGCTTCGCCAGGATATCCAGATAATTCTGATGGTTAGCACTCTCCTTGTATCAAAGTGA |
Sequence | ILIVLINRLKLTPNTIQHMLLTRLRQDIQIILMVSTLLVSK |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3665711 | 3665824 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 2943184 | 2943297 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 2903618 | 2903731 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 808080 | 808193 | - | NZ_CP061527.1 | Shigella dysenteriae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00455.24 | 1.0 | 3 | 3085.0 | same-strand | DeoR C terminal sensor domain |
2 | PF08220.14 | 1.0 | 3 | 3085.0 | same-strand | DeoR-like helix-turn-helix domain |
3 | PF08279.14 | 1.0 | 3 | 3085.0 | same-strand | HTH domain |
4 | PF18125.3 | 1.0 | 3 | 1941.0 | opposite-strand | RlmM ferredoxin-like domain |
5 | PF04241.17 | 1.0 | 3 | 1553.0 | opposite-strand | Protein of unknown function (DUF423) |
6 | PF03466.22 | 1.0 | 3 | 617.0 | opposite-strand | LysR substrate binding domain |
7 | PF00126.29 | 1.0 | 3 | 617.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
8 | PF06004.14 | 1.0 | 3 | 39.0 | opposite-strand | Bacterial protein of unknown function (DUF903) |
9 | PF00266.21 | 1.0 | 3 | 40.0 | same-strand | Aminotransferase class-V |
10 | PF02657.17 | 1.0 | 3 | 1245.0 | same-strand | Fe-S metabolism associated domain |
11 | PF00899.23 | 1.0 | 3 | 1739.0 | opposite-strand | ThiF family |
12 | PF03562.19 | 1.0 | 3 | 2784.0 | opposite-strand | MltA specific insert domain |
13 | PF06725.13 | 1.0 | 3 | 2784.0 | opposite-strand | 3D domain |
14 | PF01520.20 | 1.0 | 3 | 4405.0 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
15 | PF11741.10 | 1.0 | 3 | 4405.0 | opposite-strand | AMIN domain |