Result : EXP00748
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00748 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2886333 |
| Right | 2886521 |
| Strand | + |
| Nucleotide Sequence | ATGATATGCTACCACTTTGGGCCCTGGTGGACCAGAAAAGGGCTTGTCTCTTCTCATCAGGGTAGCTATAGTGTCGCCCCTTCGCAGACCATGGGTCTAAAGACGAAGGCAGCGCAGTCAATCAGCAGGAAGGTGGCATGTCTGCACAACCCGTCGATATCCAAATTTTTGGCCGTTCACTGCGTGTGA |
| Sequence | MICYHFGPWWTRKGLVSSHQGSYSVAPSQTMGLKTKAAQSISRKVACLHNPSISKFLAVHCV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 670200 | 670388 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1949420 | 1949608 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 2989388 | 2989576 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3055475 | 3055663 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 3792731 | 3792919 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 2992144 | 2992332 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 4244064 | 4244252 | - | NZ_CP038469.1 | Citrobacter tructae |
| 8 | 3864458 | 3864631 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 9 | 3416760 | 3416933 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 10 | 3755869 | 3756042 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 11 | 780662 | 780850 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 12 | 828959 | 829135 | - | NZ_CP045845.1 | Kluyvera intermedia |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP057657.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01571.23 | 1.0 | 11 | 4808.0 | opposite-strand | Aminomethyltransferase folate-binding domain |
| 2 | PF08669.13 | 1.0 | 11 | 4808.0 | opposite-strand | Glycine cleavage T-protein C-terminal barrel domain |
| 3 | PF01494.21 | 1.0 | 11 | 2562.5 | opposite-strand | FAD binding domain |
| 4 | PF00557.26 | 1.0 | 11 | 635.0 | opposite-strand | Metallopeptidase family M24 |
| 5 | PF05195.18 | 1.0 | 11 | 635.0 | opposite-strand | Aminopeptidase P, N-terminal domain |
| 6 | PF03695.15 | 1.0 | 11 | 31.0 | opposite-strand | Uncharacterised protein family (UPF0149) |
| 7 | PF05164.15 | 1.0 | 11 | -51.0 | same-strand | Cell division protein ZapA |
| 8 | PF01812.22 | 0.73 | 8 | 524 | same-strand | 5-formyltetrahydrofolate cyclo-ligase family |
| 9 | PF02826.21 | 1.0 | 11 | 1510.0 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
| 10 | PF00389.32 | 1.0 | 11 | 1510.0 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
| 11 | PF01842.27 | 0.91 | 10 | 1513 | opposite-strand | ACT domain |
| 12 | PF06026.16 | 0.91 | 10 | 2999 | opposite-strand | Ribose 5-phosphate isomerase A (phosphoriboisomerase A) |
| 13 | PF00126.29 | 0.73 | 8 | 3815.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 14 | PF03466.22 | 0.73 | 8 | 3815.0 | same-strand | LysR substrate binding domain |
++ More..