Result : EXP00745
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00745 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1534717 |
| Right | 1534836 |
| Strand | + |
| Nucleotide Sequence | ATGATTAACAACACTGAAGTTTTATTATTCTTACGCAGCCAAAAGGGCTTCAACAGACAGAGATACTTTGCTATCAACATACGAAGCGTAATGGGAATGGTTATCATTAGCGAAAATTGA |
| Sequence | MINNTEVLLFLRSQKGFNRQRYFAINIRSVMGMVIISEN |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1579236 | 1579355 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2100617 | 2100736 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 1762178 | 1762297 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2185723 | 2185842 | - | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13520.8 | 0.67 | 2 | 8747 | opposite-strand | Amino acid permease |
| 2 | PF00324.23 | 0.67 | 2 | 8747 | opposite-strand | Amino acid permease |
| 3 | PF00282.21 | 0.67 | 2 | 7191 | opposite-strand | Pyridoxal-dependent decarboxylase conserved domain |
| 4 | PF05193.23 | 0.67 | 2 | 4046 | opposite-strand | Peptidase M16 inactive domain |
| 5 | PF00675.22 | 0.67 | 2 | 4046 | opposite-strand | Insulinase (Peptidase family M16) |
| 6 | PF07715.17 | 1.0 | 3 | 1617.0 | opposite-strand | TonB-dependent Receptor Plug Domain |
| 7 | PF06472.17 | 1.0 | 3 | -92.5 | opposite-strand | ABC transporter transmembrane region 2 |
| 8 | PF05992.14 | 1.0 | 3 | -92.5 | opposite-strand | SbmA/BacA-like family |
| 9 | PF00005.29 | 1.0 | 3 | -32.5 | opposite-strand | ABC transporter |
| 10 | PF04055.23 | 1.0 | 3 | 278.0 | opposite-strand | Radical SAM superfamily |
| 11 | PF13186.8 | 1.0 | 3 | 278.0 | opposite-strand | Iron-sulfur cluster-binding domain |
| 12 | PF00884.25 | 1.0 | 3 | 1487.0 | opposite-strand | Sulfatase |
| 13 | PF00165.25 | 0.67 | 2 | 3573 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 14 | PF12833.9 | 0.67 | 2 | 3573 | opposite-strand | Helix-turn-helix domain |
++ More..