Protein name |
CRISPR-associated endoribonuclease Cas2 1 (EC 3.1.-.-) |
NCBI Accession ID |
CP000439.1 |
Organism |
Francisella tularensis subsp. novicida (strain U112) |
Left |
816036 |
Right |
816329 |
Strand |
+ |
Nucleotide Sequence |
ATGCAACTAAGAAAAGAATATTTAATAGCCTATGATATAGAAGATAACAAAACAAGAACAATAATCTATAAACAACTTCTAGCATATGGTCTTAAGGCAGTGCAGAAATCAGTATTTTGGGGCTATGTCAGTATTGCTGAGCTTAATGCTATCAAAAGATTGTTTGATAGCTCATTAACTATTTCAGATAAGGTATTTATTACTAGAGTAAATATGCATGAGCAAAAACTAGATTATAGCTTTGGTTACGATGACAAAACTTTCAAAGACTGGGATGAATATGGACATATTTGA |
Sequence |
MQLRKEYLIAYDIEDNKTRTIIYKQLLAYGLKAVQKSVFWGYVSIAELNAIKRLFDSSLTISDKVFITRVNMHEQKLDYSFGYDDKTFKDWDEYGHI |
Source of smORF |
Swiss-Prot |
Function |
CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette. {ECO:0000255|HAMAP-Rule:MF_01471}. |
Pubmed ID |
17550600
23584588
|
Domain |
|
Functional Category |
Metal-binding |
Uniprot ID |
A0Q5Y5
|
ORF Length (Amino Acid) |
97 |