Result : EXP00740
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00740 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3872991 |
| Right | 3873128 |
| Strand | + |
| Nucleotide Sequence | TTGGTAGCGCAACTGGTTTGGGACCAGTGGGTCGGAGGTTCGAATCCTCTCTCGCCGACCAATTTTGAACCCCGCTTCGGCGGGGTTTTTTGTTTTCTGTGCATTTCGTCACTTTCCCTTCGCAATAAACGCCCGTAA |
| Sequence | LVAQLVWDQWVGGSNPLSPTNFEPRFGGVFCFLCISSLSLRNKRP |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2792243 | 2792380 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 2 | 3951901 | 3952038 | + | NZ_AP014857.1 | Escherichia albertii |
| 3 | 4364030 | 4364167 | - | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 4776509 | 4776646 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 3982751 | 3982888 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 6 | 3991314 | 3991451 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 4312892 | 4313029 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 4172450 | 4172611 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 1391361 | 1391471 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 10 | 4585273 | 4585425 | - | NC_015968.1 | Enterobacter soli |
| 11 | 2758810 | 2758947 | + | NZ_CP033744.1 | Citrobacter freundii |
| 12 | 2331270 | 2331383 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 13 | 4598824 | 4598952 | - | NZ_CP032487.1 | Yersinia hibernica |
| 14 | 213004 | 213156 | + | NZ_CP032487.1 | Yersinia hibernica |
| 15 | 4575308 | 4575445 | - | NZ_CP043727.1 | Yersinia canariae |
| 16 | 482216 | 482329 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 17 | 4010127 | 4010240 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 18 | 481856 | 481969 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 19 | 1369555 | 1369671 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 20 | 782778 | 782891 | + | NC_011753.2 | Vibrio atlanticus |
| 21 | 1699718 | 1699852 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 22 | 3088206 | 3088322 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 23 | 1136730 | 1136852 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 24 | 1648988 | 1649101 | - | NZ_LR884459.1 | Psychrobacter arenosus |
| 25 | 292526 | 292654 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 26 | 7040648 | 7040782 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 27 | 659042 | 659161 | + | NZ_CP038157.1 | Corynebacterium sanguinis |
++ More..