Result : EXP00737
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00737 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3014305 |
| Right | 3014502 |
| Strand | + |
| Nucleotide Sequence | ATCGAACCATTTCAGTGTCCTTTGCCAGGAAAGATCGGCGGCAGATTTGTCATAACGGGGCGTGGAATCATTATGGAATCCGTGATTAACCCCCGGATAGATATACGCCTCATAAACCTTATTATTGGCTTTCAACGCCGCCTCGTAAGCAGGCCAGCCCTCGTTGATTCGGGTGTCCAGTTCCGCGAAGTGGAGTAG |
| Sequence | IEPFQCPLPGKIGGRFVITGRGIIMESVINPRIDIRLINLIIGFQRRLVSRPALVDSGVQFREVE |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 757249 | 757425 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 3146892 | 3147068 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3887373 | 3887549 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 3142329 | 3142505 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 3664654 | 3664833 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03916.16 | 1.0 | 4 | 2728 | opposite-strand | Polysulphide reductase, NrfD |
| 2 | PF13247.8 | 1.0 | 4 | 1752 | opposite-strand | 4Fe-4S dicluster domain |
| 3 | PF12838.9 | 1.0 | 4 | 1752 | opposite-strand | 4Fe-4S dicluster domain |
| 4 | PF13187.8 | 1.0 | 4 | 1752 | opposite-strand | 4Fe-4S dicluster domain |
| 5 | PF13237.8 | 1.0 | 4 | 1752 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF00037.29 | 1.0 | 4 | 1752 | opposite-strand | 4Fe-4S binding domain |
| 7 | PF12797.9 | 1.0 | 4 | 1752 | opposite-strand | 4Fe-4S binding domain |
| 8 | PF12837.9 | 1.0 | 4 | 1752 | opposite-strand | 4Fe-4S binding domain |
| 9 | PF14697.8 | 1.0 | 4 | 1752 | opposite-strand | 4Fe-4S dicluster domain |
| 10 | PF01058.24 | 1.0 | 4 | 631 | opposite-strand | NADH ubiquinone oxidoreductase, 20 Kd subunit |
| 11 | PF14720.8 | 1.0 | 4 | 631 | opposite-strand | NiFe/NiFeSe hydrogenase small subunit C-terminal |
| 12 | PF10518.11 | 1.0 | 4 | 631 | opposite-strand | TAT (twin-arginine translocation) pathway signal sequence |
| 13 | PF11115.10 | 1.0 | 4 | 155 | opposite-strand | Protein of unknown function (DUF2623) |
| 14 | PF01738.20 | 1.0 | 4 | -176.0 | opposite-strand | Dienelactone hydrolase family |
| 15 | PF03350.18 | 1.0 | 4 | 1912 | opposite-strand | Uncharacterized protein family, UPF0114 |
| 16 | PF00248.23 | 0.75 | 3 | 830.5 | same-strand | Aldo/keto reductase family |
| 17 | PF02472.18 | 0.75 | 3 | 3753 | opposite-strand | Biopolymer transport protein ExbD/TolR |
| 18 | PF01618.18 | 0.75 | 3 | 4185 | opposite-strand | MotA/TolQ/ExbB proton channel family |
++ More..