Result : EXP00735
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00735 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3413251 |
| Right | 3413346 |
| Strand | + |
| Nucleotide Sequence | GTGCAAATTCAGACACATAAAAAAACGCCATCGCTTGCATTAGAAAGGTTTCTGGCCGACCTTATAACCATTAATTACGAAGCGCAAAAAAAATAA |
| Sequence | VQIQTHKKTPSLALERFLADLITINYEAQKK |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4265191 | 4265286 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3552955 | 3553050 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3524184 | 3524279 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 211530 | 211625 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 3509247 | 3509342 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 4037956 | 4038051 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18912.2 | 0.6 | 3 | 7357.5 | same-strand | Double zinc ribbon domain |
| 2 | PF01106.19 | 0.8 | 4 | 6756 | same-strand | NifU-like domain |
| 3 | PF01521.22 | 0.8 | 4 | 6756 | same-strand | Iron-sulphur cluster biosynthesis |
| 4 | PF02447.18 | 1.0 | 5 | 5081.5 | same-strand | GntP family permease |
| 5 | PF03600.18 | 1.0 | 5 | 5081.5 | same-strand | Citrate transporter |
| 6 | PF02446.19 | 1.0 | 5 | 2891.0 | opposite-strand | 4-alpha-glucanotransferase |
| 7 | PF00343.22 | 1.0 | 5 | 482.0 | opposite-strand | Carbohydrate phosphorylase |
| 8 | PF17874.3 | 1.0 | 5 | 35.0 | same-strand | MalT-like TPR region |
| 9 | PF00196.21 | 1.0 | 5 | 35.0 | same-strand | Bacterial regulatory proteins, luxR family |
| 10 | PF01137.23 | 1.0 | 5 | 2783.0 | opposite-strand | RNA 3'-terminal phosphate cyclase |
| 11 | PF05189.15 | 1.0 | 5 | 2783.0 | opposite-strand | RNA 3'-terminal phosphate cyclase (RTC), insert domain |
| 12 | PF01139.19 | 0.8 | 4 | 3803 | opposite-strand | tRNA-splicing ligase RtcB |
| 13 | PF06956.13 | 0.6 | 3 | 5218 | same-strand | Regulator of RNA terminal phosphate cyclase |
| 14 | PF00158.28 | 0.6 | 3 | 5218 | same-strand | Sigma-54 interaction domain |
| 15 | PF14532.8 | 0.6 | 3 | 5218 | same-strand | Sigma-54 interaction domain |
| 16 | PF07728.16 | 0.6 | 3 | 5218 | same-strand | AAA domain (dynein-related subfamily) |
| 17 | PF00455.24 | 0.6 | 3 | 6798 | opposite-strand | DeoR C terminal sensor domain |
| 18 | PF13191.8 | 0.6 | 3 | 35 | same-strand | AAA ATPase domain |
++ More..