Result : EXP00734
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00734 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1009912 |
| Right | 1010013 |
| Strand | + |
| Nucleotide Sequence | ATGAGTTTACTTTTCAGCAATTACGCCGTATTACAGGAACGCCGTTTGAAGCACTGGTGCGGCAGAAAGTGCCTGCGAAACCTGTTAACTGCATGGGCCTGA |
| Sequence | MSLLFSNYAVLQERRLKHWCGRKCLRNLLTAWA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1004823 | 1004924 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 991890 | 991991 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2746542 | 2746643 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 1134295 | 1134396 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1671562 | 1671663 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 2549427 | 2549528 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 7 | 71617 | 71718 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 1619652 | 1619753 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 9 | 1644404 | 1644505 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 10 | 803956 | 804057 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 11 | 1589299 | 1589400 | + | NC_015968.1 | Enterobacter soli |
| 12 | 1838326 | 1838427 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 13 | 3352172 | 3352273 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01180.23 | 1.0 | 12 | -101 | same-strand | Dihydroorotate dehydrogenase |
| 2 | PF07126.14 | 1.0 | 12 | 1023 | same-strand | Cell-division protein ZapC |
| 3 | PF03473.19 | 1.0 | 12 | 1562 | opposite-strand | MOSC domain |
| 4 | PF03476.18 | 1.0 | 12 | 1562 | opposite-strand | MOSC N-terminal beta barrel domain |
| 5 | PF00111.29 | 1.0 | 12 | 1562 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 6 | PF01170.20 | 1.0 | 12 | 2774 | same-strand | Putative RNA methylase family UPF0020 |
| 7 | PF02926.19 | 1.0 | 12 | 2774 | same-strand | THUMP domain |
| 8 | PF13649.8 | 0.75 | 9 | 2848.0 | same-strand | Methyltransferase domain |
| 9 | PF00005.29 | 1.0 | 12 | 4890 | same-strand | ABC transporter |
| 10 | PF16326.7 | 1.0 | 12 | 4894 | same-strand | ABC transporter C-terminal domain |
| 11 | PF02463.21 | 0.92 | 11 | 4896.0 | same-strand | RecF/RecN/SMC N terminal domain |
| 12 | PF12848.9 | 1.0 | 12 | 4894 | same-strand | ABC transporter |
| 13 | PF13401.8 | 0.92 | 11 | 4890 | same-strand | AAA domain |
| 14 | PF04403.15 | 0.67 | 8 | 6931 | same-strand | Paraquat-inducible protein A |
| 15 | PF00528.24 | 0.67 | 8 | 2985.5 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
| 16 | PF00296.22 | 0.67 | 8 | 1830.0 | opposite-strand | Luciferase-like monooxygenase |
| 17 | PF04069.14 | 0.67 | 8 | 872.0 | opposite-strand | Substrate binding domain of ABC-type glycine betaine transport system |
| 18 | PF03358.17 | 0.67 | 8 | 304.5 | opposite-strand | NADPH-dependent FMN reductase |
++ More..