Result : EXP00730
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00730 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 4261564 |
| Right | 4261713 |
| Strand | + |
| Nucleotide Sequence | ATGATACGACGGGTCATCATTCGGCCAGCAACCGAGACTTCAATGTTTAAGGATTCCAGTTCCTGGTTATCCTTCGCATCAAACTCTTCGTGCAACTGCTCAGAGGTATGGTCGCGGCGAAAATCATTGGGAAACGCCACACCTTGCTGA |
| Sequence | MIRRVIIRPATETSMFKDSSSWLSFASNSSCNCSEVWSRRKSLGNATPC |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5209056 | 5209205 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3786537 | 3786686 | - | NZ_AP014857.1 | Escherichia albertii |
| 3 | 4354479 | 4354628 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 380466 | 380615 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 3930297 | 3930455 | + | NZ_CP041247.1 | Raoultella electrica |
| 6 | 3068602 | 3068760 | - | NZ_CP026047.1 | Raoultella planticola |
| 7 | 4156702 | 4156860 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 8 | 881701 | 881859 | + | NZ_CP042941.1 | Atlantibacter hermannii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00152.22 | 1.0 | 7 | -153.5 | opposite-strand | tRNA synthetases class II (D, K and N) |
| 2 | PF01336.27 | 1.0 | 7 | -153.5 | opposite-strand | OB-fold nucleic acid binding domain |
| 3 | PF00854.23 | 0.86 | 6 | 326 | opposite-strand | POT family |
| 4 | PF07690.18 | 0.86 | 6 | 326 | opposite-strand | Major Facilitator Superfamily |
| 5 | PF01276.22 | 0.86 | 6 | 1842 | opposite-strand | Orn/Lys/Arg decarboxylase, major domain |
| 6 | PF03711.17 | 0.86 | 6 | 1842 | opposite-strand | Orn/Lys/Arg decarboxylase, C-terminal domain |
| 7 | PF03709.17 | 0.86 | 6 | 1842 | opposite-strand | Orn/Lys/Arg decarboxylase, N-terminal domain |
| 8 | PF13520.8 | 0.86 | 6 | 4069 | opposite-strand | Amino acid permease |
| 9 | PF18500.3 | 0.86 | 6 | 5769 | opposite-strand | CadC C-terminal domain 1 |
| 10 | PF00486.30 | 0.86 | 6 | 5769 | opposite-strand | Transcriptional regulatory protein, C terminal |
++ More..