Result : EXP00717
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00717 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 705148 |
| Right | 705321 |
| Strand | + |
| Nucleotide Sequence | ATGAGAATAAGCATCATGGGGCGCTGTTTCGCTTTAAGGTTTTTCATCGTGATGGCGAACCGTGCGAACGCTGTGGCAGCATCATTGAGAAAACCACGCTGTCATCTCGCCCGTTTTACTGGTGCCCTGGCTGCCAGCACTAGGCCGACCGCTTCGGCGCATAGGTTGAAATAA |
| Sequence | MRISIMGRCFALRFFIVMANRANAVAASLRKPRCHLARFTGALAASTRPTASAHRLK |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 746584 | 746757 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3001787 | 3001960 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 823231 | 823404 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 610318 | 610491 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1377235 | 1377408 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 3687290 | 3687445 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 7 | 2947080 | 2947253 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 3885825 | 3885989 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 9 | 1376806 | 1376958 | + | NZ_AP023184.1 | Buttiauxella agrestis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02682.18 | 0.62 | 5 | 2335.0 | same-strand | Carboxyltransferase domain, subdomain C and D |
| 2 | PF03746.18 | 0.88 | 7 | 685.0 | same-strand | LamB/YcsF family |
| 3 | PF01149.26 | 1.0 | 8 | -142 | same-strand | Formamidopyrimidine-DNA glycosylase N-terminal domain |
| 4 | PF06831.16 | 1.0 | 8 | -142 | same-strand | Formamidopyrimidine-DNA glycosylase H2TH domain |
| 5 | PF06827.16 | 1.0 | 8 | -142 | same-strand | Zinc finger found in FPG and IleRS |
| 6 | PF05145.14 | 0.62 | 5 | -34.0 | opposite-strand | Transition state regulatory protein AbrB |
++ More..