Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00714 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 4083820 |
Right | 4084002 |
Strand | + |
Nucleotide Sequence | TTGGTAGAGCGCACCCTTGGTAAGGGTGAGGTCGGCAGTTCGAATCTGCCTATCAGCACCACTTCTTTTCTCCTCCCTGTTTTTTCCTTCTGTTTATTGCATTCAACAAGTCGGGCATGTTGCCTGGTTGATGTGGTGATATCACCGATTTATCCGTGTCTTAGAGGGACAATCGATGTCTAA |
Sequence | LVERTLGKGEVGSSNLPISTTSFLLPVFSFCLLHSTSRACCLVDVVISPIYPCLRGTIDV |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 60 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 108276 | 108458 | + | NZ_CP061527.1 | Shigella dysenteriae |
2 | 215780 | 215962 | + | NZ_LR134340.1 | Escherichia marmotae |
3 | 3118802 | 3118984 | + | NZ_CP057657.1 | Escherichia fergusonii |
4 | 4195521 | 4195703 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 4175769 | 4175951 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
6 | 4148207 | 4148389 | + | NZ_AP014857.1 | Escherichia albertii |
7 | 4984913 | 4985095 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
8 | 4270449 | 4270628 | - | NZ_AP023184.1 | Buttiauxella agrestis |
9 | 5838405 | 5838587 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
10 | 3942642 | 3942818 | - | NZ_CP014137.1 | Brenneria goodwinii |
11 | 4520976 | 4521155 | - | NZ_CP006569.1 | Sodalis praecaptivus |
12 | 3527898 | 3528077 | - | NZ_LN907827.1 | Erwinia gerundensis |
13 | 3869635 | 3869811 | - | NZ_CP045720.1 | Pantoea eucalypti |
14 | 209046 | 209222 | + | NZ_CP034148.1 | Pantoea agglomerans |
15 | 3879803 | 3879979 | - | NZ_CP038853.1 | Pantoea vagans |
16 | 3713180 | 3713359 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
17 | 173126 | 173308 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
18 | 293170 | 293352 | + | NC_014306.1 | Erwinia billingiae Eb661 |
19 | 3499998 | 3500195 | - | NZ_LS483470.1 | Leminorella richardii |
20 | 1442630 | 1442782 | - | NZ_CP042941.1 | Atlantibacter hermannii |
21 | 3924397 | 3924582 | - | NZ_CP015581.1 | Tatumella citrea |
22 | 160304 | 160498 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
23 | 3759458 | 3759616 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
24 | 1716418 | 1716576 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
25 | 3315707 | 3315880 | - | NZ_CP071325.1 | Photobacterium ganghwense |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02873.18 | 0.88 | 21 | 2904.5 | same-strand | UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain |
2 | PF01565.25 | 0.88 | 21 | 2904.5 | same-strand | FAD binding domain |
3 | PF03099.21 | 0.88 | 21 | 1945.5 | same-strand | Biotin/lipoate A/B protein ligase family |
4 | PF08279.14 | 0.88 | 21 | 1945.5 | same-strand | HTH domain |
5 | PF02237.19 | 0.88 | 21 | 1945.5 | same-strand | Biotin protein ligase C terminal domain |
6 | PF00009.29 | 0.92 | 22 | -7 | same-strand | Elongation factor Tu GTP binding domain |
7 | PF03143.19 | 0.92 | 22 | -7 | same-strand | Elongation factor Tu C-terminal domain |
8 | PF03144.27 | 0.92 | 22 | -7 | same-strand | Elongation factor Tu domain 2 |
9 | PF01926.25 | 0.92 | 22 | -7 | same-strand | 50S ribosome-binding GTPase |
10 | PF00584.22 | 0.92 | 22 | 1409 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
11 | PF02357.21 | 0.92 | 22 | 1794 | same-strand | Transcription termination factor nusG |
12 | PF00467.31 | 0.92 | 22 | 1794 | same-strand | KOW motif |
13 | PF03946.16 | 0.92 | 22 | 2496 | same-strand | Ribosomal protein L11, N-terminal domain |
14 | PF00298.21 | 0.92 | 22 | 2496 | same-strand | Ribosomal protein L11, RNA binding domain |
15 | PF00687.23 | 0.92 | 22 | 2928 | same-strand | Ribosomal protein L1p/L10e family |