Result : EXP00714

Protein Information

• Protein name: EXP00714
• NCBI Accession ID: CP001509.3
• Organism: Escherichia coli BL21(DE3)
• Left: 4083820
• Right: 4084002
• Strand: +
• Nucleotide Sequence: TTGGTAGAGCGCACCCTTGGTAAGGGTGAGGTCGGCAGTTCGAATCTGCCTATCAGCACCACTTCTTTTCTCCTCCCTGTTTTTTCCTTCTGTTTATTGCATTCAACAAGTCGGGCATGTTGCCTGGTTGATGTGGTGATATCACCGATTTATCCGTGTCTTAGAGGGACAATCGATGTCTAA
• Sequence: LVERTLGKGEVGSSNLPISTTSFLLPVFSFCLLHSTSRACCLVDVVISPIYPCLRGTIDV
• Source of smORF: Ribo-seq
• Pubmed ID: 30904393
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 60

Conservation Analysis

No. of Species: 24

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	108276	108458	+	NZ_CP061527.1	Shigella dysenteriae
2	215780	215962	+	NZ_LR134340.1	Escherichia marmotae
3	3118802	3118984	+	NZ_CP057657.1	Escherichia fergusonii
4	4195521	4195703	+	NC_004337.2	Shigella flexneri 2a str. 301
5	4175769	4175951	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
6	4148207	4148389	+	NZ_AP014857.1	Escherichia albertii
7	4984913	4985095	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai
8	4270449	4270628	-	NZ_AP023184.1	Buttiauxella agrestis
9	5838405	5838587	-	NZ_CP036175.1	Klebsiella huaxiensis
10	3942642	3942818	-	NZ_CP014137.1	Brenneria goodwinii
11	4520976	4521155	-	NZ_CP006569.1	Sodalis praecaptivus
12	3527898	3528077	-	NZ_LN907827.1	Erwinia gerundensis
13	3869635	3869811	-	NZ_CP045720.1	Pantoea eucalypti
14	209046	209222	+	NZ_CP034148.1	Pantoea agglomerans
15	3879803	3879979	-	NZ_CP038853.1	Pantoea vagans
16	3713180	3713359	-	NZ_CP023567.1	Erwinia pyrifoliae
17	173126	173308	+	NC_010694.1	Erwinia tasmaniensis Et1/99
18	293170	293352	+	NC_014306.1	Erwinia billingiae Eb661
19	3499998	3500195	-	NZ_LS483470.1	Leminorella richardii
20	1442630	1442782	-	NZ_CP042941.1	Atlantibacter hermannii
21	3924397	3924582	-	NZ_CP015581.1	Tatumella citrea
22	160304	160498	-	NZ_CP005974.1	Photobacterium gaetbulicola Gung47
23	3759458	3759616	-	NC_012779.2	Edwardsiella ictaluri 93-146
24	1716418	1716576	-	NZ_CP006664.1	Edwardsiella anguillarum ET080813
25	3315707	3315880	-	NZ_CP071325.1	Photobacterium ganghwense

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP061527.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02873.18	0.88	21	2904.5	same-strand	UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
2	PF01565.25	0.88	21	2904.5	same-strand	FAD binding domain
3	PF03099.21	0.88	21	1945.5	same-strand	Biotin/lipoate A/B protein ligase family
4	PF08279.14	0.88	21	1945.5	same-strand	HTH domain
5	PF02237.19	0.88	21	1945.5	same-strand	Biotin protein ligase C terminal domain
6	PF00009.29	0.92	22	-7	same-strand	Elongation factor Tu GTP binding domain
7	PF03143.19	0.92	22	-7	same-strand	Elongation factor Tu C-terminal domain
8	PF03144.27	0.92	22	-7	same-strand	Elongation factor Tu domain 2
9	PF01926.25	0.92	22	-7	same-strand	50S ribosome-binding GTPase
10	PF00584.22	0.92	22	1409	same-strand	SecE/Sec61-gamma subunits of protein translocation complex
11	PF02357.21	0.92	22	1794	same-strand	Transcription termination factor nusG
12	PF00467.31	0.92	22	1794	same-strand	KOW motif
13	PF03946.16	0.92	22	2496	same-strand	Ribosomal protein L11, N-terminal domain
14	PF00298.21	0.92	22	2496	same-strand	Ribosomal protein L11, RNA binding domain
15	PF00687.23	0.92	22	2928	same-strand	Ribosomal protein L1p/L10e family