Result : EXP00709

Protein Information

• Protein name: EXP00709
• NCBI Accession ID: CP001509.3
• Organism: Escherichia coli BL21(DE3)
• Left: 3265651
• Right: 3265815
• Strand: +
• Nucleotide Sequence: TTGAAATCATTATTCAATCGGTTAACGGGAAAAGCGGTTAGCCGGACAGCTTTCGTCGAACACCTTGGTCAGGAAGTTATACAACATCATCCAAACTGGAAAGTCATGATTTCGACTGACCACAAATTGATGCGCATTGATACTCCACTAAACAGCTATTATTGA
• Sequence: LKSLFNRLTGKAVSRTAFVEHLGQEVIQHHPNWKVMISTDHKLMRIDTPLNSYY
• Source of smORF: Ribo-seq
• Pubmed ID: 30904393
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 54

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3404495	3404659	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	4139583	4139747	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai
3	3392066	3392230	+	NC_004337.2	Shigella flexneri 2a str. 301

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000913.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF04093.14	1.0	2	5620	opposite-strand	rod shape-determining protein MreD
2	PF04085.16	1.0	2	4517	opposite-strand	rod shape-determining protein MreC
3	PF06723.15	1.0	2	3408	opposite-strand	MreB/Mbl protein
4	PF14450.8	1.0	2	3408	opposite-strand	Cell division protein FtsA
5	PF00563.22	1.0	2	1163	opposite-strand	EAL domain
6	PF17157.6	1.0	2	1163	opposite-strand	Gammaproteobacterial periplasmic sensor domain
7	PF00990.23	1.0	2	1163	opposite-strand	Diguanylate cyclase, GGDEF domain
8	PF00107.28	1.0	2	37	same-strand	Zinc-binding dehydrogenase
9	PF00364.24	1.0	2	777	same-strand	Biotin-requiring enzyme
10	PF02786.19	1.0	2	1258	same-strand	Carbamoyl-phosphate synthase L chain, ATP binding domain
11	PF00289.24	1.0	2	1258	same-strand	Biotin carboxylase, N-terminal domain
12	PF02785.21	1.0	2	1258	same-strand	Biotin carboxylase C-terminal domain
13	PF02655.16	1.0	2	1258	same-strand	ATP-grasp domain
14	PF02222.24	1.0	2	1258	same-strand	ATP-grasp domain
15	PF06196.14	1.0	2	2716	same-strand	Protein of unknown function (DUF997)
16	PF00474.19	1.0	2	2948	same-strand	Sodium:solute symporter family