Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00709 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 3265651 |
Right | 3265815 |
Strand | + |
Nucleotide Sequence | TTGAAATCATTATTCAATCGGTTAACGGGAAAAGCGGTTAGCCGGACAGCTTTCGTCGAACACCTTGGTCAGGAAGTTATACAACATCATCCAAACTGGAAAGTCATGATTTCGACTGACCACAAATTGATGCGCATTGATACTCCACTAAACAGCTATTATTGA |
Sequence | LKSLFNRLTGKAVSRTAFVEHLGQEVIQHHPNWKVMISTDHKLMRIDTPLNSYY |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 54 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3404495 | 3404659 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 4139583 | 4139747 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 3392066 | 3392230 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04093.14 | 1.0 | 2 | 5620 | opposite-strand | rod shape-determining protein MreD |
2 | PF04085.16 | 1.0 | 2 | 4517 | opposite-strand | rod shape-determining protein MreC |
3 | PF06723.15 | 1.0 | 2 | 3408 | opposite-strand | MreB/Mbl protein |
4 | PF14450.8 | 1.0 | 2 | 3408 | opposite-strand | Cell division protein FtsA |
5 | PF00563.22 | 1.0 | 2 | 1163 | opposite-strand | EAL domain |
6 | PF17157.6 | 1.0 | 2 | 1163 | opposite-strand | Gammaproteobacterial periplasmic sensor domain |
7 | PF00990.23 | 1.0 | 2 | 1163 | opposite-strand | Diguanylate cyclase, GGDEF domain |
8 | PF00107.28 | 1.0 | 2 | 37 | same-strand | Zinc-binding dehydrogenase |
9 | PF00364.24 | 1.0 | 2 | 777 | same-strand | Biotin-requiring enzyme |
10 | PF02786.19 | 1.0 | 2 | 1258 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
11 | PF00289.24 | 1.0 | 2 | 1258 | same-strand | Biotin carboxylase, N-terminal domain |
12 | PF02785.21 | 1.0 | 2 | 1258 | same-strand | Biotin carboxylase C-terminal domain |
13 | PF02655.16 | 1.0 | 2 | 1258 | same-strand | ATP-grasp domain |
14 | PF02222.24 | 1.0 | 2 | 1258 | same-strand | ATP-grasp domain |
15 | PF06196.14 | 1.0 | 2 | 2716 | same-strand | Protein of unknown function (DUF997) |
16 | PF00474.19 | 1.0 | 2 | 2948 | same-strand | Sodium:solute symporter family |