Result : B1YEG1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP001022.1 |
| Organism | Exiguobacterium sibiricum (strain DSM 17290 / CIP 109462 / JCM 13490 / 255-15) |
| Left | 2666436 |
| Right | 2666648 |
| Strand | - |
| Nucleotide Sequence | ATGGAACTTATTGCAACAGCGATCATCATCGGACTCGGCGCACTCGGCGCAGGTATCGGTAACGGTCTTATCGTAAACGGTACAGTATTAGGACAAGCACGTCAGCCAGAACTCAAAAACGAACTTCGTCAAACAATGTTCATCGGTATCGGTCTCGTTGAGGCACTTCCAATCATCGGTGTAGCGGTCGGTTTCCTTCTTCTCAACTCTTAA |
| Sequence | MELIATAIIIGLGALGAGIGNGLIVNGTVLGQARQPELKNELRQTMFIGIGLVEALPIIGVAVGFLLLNS |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | B1YEG1 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 148
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2666436 | 2666648 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 2 | 346148 | 346360 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 3 | 809348 | 809560 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 4 | 1665233 | 1665445 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 5 | 1846748 | 1846960 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 6 | 1614669 | 1614881 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 7 | 37198 | 37410 | - | NZ_CP027770.1 | Staphylococcus felis |
| 8 | 505875 | 506087 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 9 | 108283 | 108501 | + | NZ_CP040336.1 | Bacillus luti |
| 10 | 5043350 | 5043568 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 11 | 5064199 | 5064417 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 12 | 5229627 | 5229845 | - | NC_011725.1 | Bacillus cereus B4264 |
| 13 | 5267343 | 5267561 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 14 | 3889113 | 3889331 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 15 | 1607928 | 1608140 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 16 | 1676101 | 1676313 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 17 | 2365379 | 2365591 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 18 | 3061902 | 3062126 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 19 | 956564 | 956776 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 20 | 839239 | 839445 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 21 | 1873328 | 1873534 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 22 | 1012431 | 1012643 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 23 | 2074180 | 2074392 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 24 | 708338 | 708550 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 25 | 870320 | 870532 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 26 | 51585 | 51797 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 27 | 105949 | 106161 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 28 | 819890 | 820102 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 29 | 1325348 | 1325560 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 30 | 860725 | 860937 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 31 | 609125 | 609337 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 32 | 897916 | 898128 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 33 | 2041914 | 2042126 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 34 | 2128112 | 2128324 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 35 | 2172982 | 2173194 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 36 | 896533 | 896739 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 37 | 4102697 | 4102912 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 38 | 4893383 | 4893595 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 39 | 240037 | 240252 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 40 | 6363324 | 6363548 | - | NZ_AP019400.1 | Cohnella abietis |
| 41 | 1727052 | 1727279 | - | NZ_LT906470.1 | Veillonella rodentium |
| 42 | 1145478 | 1145693 | - | NZ_CP021434.1 | Tumebacillus avium |
| 43 | 776821 | 777033 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 44 | 574229 | 574450 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 45 | 882658 | 882870 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 46 | 745608 | 745832 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 47 | 804662 | 804886 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 48 | 380075 | 380287 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 49 | 3905860 | 3906072 | - | NZ_LS483476.1 | Lederbergia lentus |
| 50 | 4349514 | 4349720 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 51 | 1007331 | 1007543 | + | NZ_CP026363.1 | Brevibacillus agri |
| 52 | 3824957 | 3825172 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 53 | 2405833 | 2406045 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 54 | 891148 | 891384 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 55 | 1787273 | 1787485 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 56 | 5297826 | 5298047 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 57 | 3519967 | 3520146 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 58 | 4681534 | 4681725 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 59 | 1858784 | 1858996 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 60 | 1104149 | 1104361 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 61 | 1151183 | 1151395 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 62 | 2521205 | 2521423 | - | NZ_LT906444.1 | Listeria welshimeri |
| 63 | 939239 | 939451 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 64 | 4224710 | 4224892 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 65 | 1403822 | 1404037 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 66 | 6645154 | 6645369 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 67 | 1375890 | 1376105 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 68 | 7365336 | 7365554 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 69 | 2499745 | 2499963 | - | NZ_LR134483.1 | Listeria grayi |
| 70 | 2506195 | 2506413 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 71 | 2635953 | 2636171 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 72 | 2611192 | 2611410 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 73 | 1405277 | 1405480 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 74 | 528500 | 528718 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 75 | 1761820 | 1761993 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 76 | 6115560 | 6115745 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 77 | 2470173 | 2470385 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 78 | 440682 | 440855 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 79 | 1360982 | 1361200 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 80 | 3404617 | 3404796 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 81 | 2566865 | 2567044 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 82 | 413460 | 413639 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 83 | 2535068 | 2535247 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 84 | 2283167 | 2283358 | - | NZ_CP031422.1 | Microbacterium oxydans |
| 85 | 2242997 | 2243218 | + | NZ_CP068161.1 | Corynebacterium propinquum |
| 86 | 5854257 | 5854472 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 87 | 975197 | 975406 | + | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 88 | 3420997 | 3421203 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 89 | 4903689 | 4903904 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 90 | 2165783 | 2166004 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 91 | 4026833 | 4027048 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 92 | 2774033 | 2774257 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 93 | 1469645 | 1469884 | - | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 94 | 1571135 | 1571377 | - | NZ_LS483460.1 | Corynebacterium minutissimum |
| 95 | 6516161 | 6516385 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 96 | 1766701 | 1766892 | - | NZ_LR698967.1 | Corynebacterium ammoniagenes |
| 97 | 1716438 | 1716632 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 98 | 2591776 | 2591994 | - | NZ_CP034118.1 | Staphylospora marina |
| 99 | 1475049 | 1475249 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 100 | 335099 | 335308 | + | NZ_CP011381.2 | Moraxella bovoculi |
| 101 | 380349 | 380558 | + | NZ_CP011158.1 | Moraxella ovis |
| 102 | 2543994 | 2544212 | + | NZ_CP065682.1 | Brevibacterium casei |
| 103 | 1432690 | 1432896 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 104 | 1862504 | 1862722 | + | NZ_CP025333.1 | Brevibacterium aurantiacum |
| 105 | 2497775 | 2498023 | - | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 106 | 2862245 | 2862493 | - | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 107 | 3130530 | 3130778 | - | NZ_CP014945.1 | Psychrobacter alimentarius |
| 108 | 2312143 | 2312391 | + | NZ_LR884459.1 | Psychrobacter arenosus |
| 109 | 1695544 | 1695750 | + | NZ_CP026734.1 | Brevibacterium linens |
| 110 | 1316609 | 1316857 | - | NZ_CP012678.1 | Psychrobacter urativorans |
| 111 | 1925202 | 1925429 | + | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 112 | 1392118 | 1392318 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 113 | 2528430 | 2528654 | - | NZ_CP034759.1 | Litorilituus sediminis |
| 114 | 2284398 | 2284613 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 115 | 6496487 | 6496699 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 116 | 1051631 | 1051801 | + | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 117 | 113294 | 113479 | - | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 118 | 1007282 | 1007491 | + | NZ_CP031423.1 | Microbacterium lemovicicum |
| 119 | 57739 | 57939 | + | NC_003910.7 | Colwellia psychrerythraea 34H |
| 120 | 2225994 | 2226203 | - | NZ_CP044231.1 | Microbacterium caowuchunii |
| 121 | 6393183 | 6393395 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 122 | 952430 | 952615 | + | NZ_CP064760.1 | Microbacterium schleiferi |
| 123 | 1297005 | 1297217 | - | NZ_CP034438.1 | Flaviflexus salsibiostraticola |
| 124 | 183975 | 184160 | - | NZ_CP061344.1 | Microbacterium hominis |
| 125 | 52591 | 52815 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 126 | 476102 | 476350 | + | NZ_CP013729.1 | Roseateles depolymerans |
| 127 | 7631822 | 7632034 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 128 | 1521948 | 1522160 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 129 | 357789 | 358037 | + | NC_015677.1 | Ramlibacter tataouinensis TTB310 |
| 130 | 746696 | 746896 | - | NZ_LR134378.1 | Lautropia mirabilis |
| 131 | 2401478 | 2401699 | + | NZ_CP032630.1 | Protaetiibacter intestinalis |
| 132 | 1669251 | 1669478 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 133 | 1725074 | 1725301 | - | NZ_LR134375.1 | Veillonella dispar |
| 134 | 1785729 | 1785956 | - | NZ_LR778174.1 | Veillonella parvula |
| 135 | 3734518 | 3734730 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 136 | 212410 | 212622 | - | NZ_CP035494.1 | Microbacterium protaetiae |
| 137 | 1263826 | 1264029 | - | NZ_CP027669.1 | Simplicispira suum |
| 138 | 3871792 | 3871992 | - | NZ_CP033433.1 | Cohnella candidum |
| 139 | 125808 | 126017 | + | NZ_LR134477.1 | Actinomyces viscosus |
| 140 | 5966374 | 5966586 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 141 | 1518834 | 1519037 | - | NZ_LR134357.1 | Actinomyces israelii |
| 142 | 722909 | 723112 | + | NZ_CP066802.1 | Actinomyces weissii |
| 143 | 177249 | 177470 | + | NZ_CP012154.1 | Wenzhouxiangella marina |
| 144 | 1804103 | 1804312 | + | NZ_CP014228.1 | Actinomyces radicidentis |
| 145 | 1106109 | 1106300 | - | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 146 | 4288550 | 4288789 | - | NZ_CP036422.1 | Halioglobus maricola |
| 147 | 4467179 | 4467400 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 148 | 5176135 | 5176332 | - | NZ_CP015839.1 | Marinobacterium aestuarii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010556.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 0.99 | 147 | 1576 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 1.0 | 148 | 1733.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 3 | PF00231.21 | 0.99 | 147 | 2788 | same-strand | ATP synthase |
| 4 | PF00306.29 | 1.0 | 148 | 1183.0 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 5 | PF00213.20 | 0.95 | 141 | 602 | same-strand | ATP synthase delta (OSCP) subunit |
| 6 | PF00430.20 | 0.99 | 147 | 97 | same-strand | ATP synthase B/B' CF(0) |
| 7 | PF00119.22 | 1.0 | 148 | 71.0 | same-strand | ATP synthase A chain |
| 8 | PF03899.17 | 0.7 | 104 | 842.0 | same-strand | ATP synthase I chain |
++ More..