Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00708 |
NCBI Accession ID | CP001509.3 |
Organism | Escherichia coli BL21(DE3) |
Left | 4358305 |
Right | 4358421 |
Strand | + |
Nucleotide Sequence | ATTACCGCAATAAGGAGCAAAAAATCAGCATCGGGCCACACTGCTGGCTTAACCCGAATGCGGAACTGTGCGTGCCGCAAACTATCGATGCGGGTGCCGAAGGGCGTGCGGTGGTGA |
Sequence | ITAIRSKKSASGHTAGLTRMRNCACRKLSMRVPKGVRW |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 38 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5301781 | 5301906 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 4446174 | 4446299 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 4441698 | 4441823 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 3813043 | 3813168 | - | NZ_CP061527.1 | Shigella dysenteriae |
5 | 480649 | 480780 | + | NZ_LR134340.1 | Escherichia marmotae |
6 | 3404633 | 3404758 | + | NZ_CP057657.1 | Escherichia fergusonii |
7 | 4074853 | 4074978 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
8 | 4339449 | 4339553 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
9 | 3689283 | 3689402 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
10 | 2245576 | 2245701 | + | NZ_CP026047.1 | Raoultella planticola |
11 | 3938220 | 3938345 | + | NZ_CP023529.1 | Lelliottia amnigena |
12 | 5001053 | 5001178 | - | NZ_CP054254.1 | Klebsiella variicola |
13 | 859415 | 859510 | - | NZ_CP033744.1 | Citrobacter freundii |
14 | 5482855 | 5482959 | - | NZ_CP060111.1 | Klebsiella michiganensis |
15 | 5360470 | 5360598 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
16 | 468603 | 468710 | + | NC_015968.1 | Enterobacter soli |
17 | 484004 | 484108 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
18 | 462978 | 463109 | + | NZ_AP022508.1 | Enterobacter bugandensis |
19 | 1184045 | 1184152 | - | NZ_CP042941.1 | Atlantibacter hermannii |
20 | 496124 | 496249 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
21 | 1751293 | 1751418 | + | NZ_CP040428.1 | Jejubacter calystegiae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06526.14 | 0.65 | 13 | 6366.0 | same-strand | Protein of unknown function (DUF1107) |
2 | PF01595.22 | 0.8 | 16 | 4880 | opposite-strand | Cyclin M transmembrane N-terminal domain |
3 | PF03471.19 | 0.8 | 16 | 4880 | opposite-strand | Transporter associated domain |
4 | PF01625.23 | 0.95 | 19 | 3998.5 | opposite-strand | Peptide methionine sulfoxide reductase |
5 | PF01103.25 | 0.9 | 18 | 2059 | same-strand | Omp85 superfamily domain |
6 | PF17243.4 | 0.95 | 19 | 2057.5 | same-strand | POTRA domain TamA domain 1 |
7 | PF04357.15 | 0.95 | 19 | -125.0 | same-strand | TamB, inner membrane protein subunit of TAM complex |
8 | PF06094.14 | 0.95 | 19 | 1595.0 | same-strand | Gamma-glutamyl cyclotransferase, AIG2-like |
9 | PF00719.21 | 0.7 | 14 | 2913 | opposite-strand | Inorganic pyrophosphatase |