Result : EXP00708
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00708 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 4358305 |
| Right | 4358421 |
| Strand | + |
| Nucleotide Sequence | ATTACCGCAATAAGGAGCAAAAAATCAGCATCGGGCCACACTGCTGGCTTAACCCGAATGCGGAACTGTGCGTGCCGCAAACTATCGATGCGGGTGCCGAAGGGCGTGCGGTGGTGA |
| Sequence | ITAIRSKKSASGHTAGLTRMRNCACRKLSMRVPKGVRW |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 20
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5301781 | 5301906 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4446174 | 4446299 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4441698 | 4441823 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3813043 | 3813168 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 480649 | 480780 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 3404633 | 3404758 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 4074853 | 4074978 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 8 | 4339449 | 4339553 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 9 | 3689283 | 3689402 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 10 | 2245576 | 2245701 | + | NZ_CP026047.1 | Raoultella planticola |
| 11 | 3938220 | 3938345 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 12 | 5001053 | 5001178 | - | NZ_CP054254.1 | Klebsiella variicola |
| 13 | 859415 | 859510 | - | NZ_CP033744.1 | Citrobacter freundii |
| 14 | 5482855 | 5482959 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 15 | 5360470 | 5360598 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 16 | 468603 | 468710 | + | NC_015968.1 | Enterobacter soli |
| 17 | 484004 | 484108 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 18 | 462978 | 463109 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 19 | 1184045 | 1184152 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 20 | 496124 | 496249 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 21 | 1751293 | 1751418 | + | NZ_CP040428.1 | Jejubacter calystegiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06526.14 | 0.65 | 13 | 6366.0 | same-strand | Protein of unknown function (DUF1107) |
| 2 | PF01595.22 | 0.8 | 16 | 4880 | opposite-strand | Cyclin M transmembrane N-terminal domain |
| 3 | PF03471.19 | 0.8 | 16 | 4880 | opposite-strand | Transporter associated domain |
| 4 | PF01625.23 | 0.95 | 19 | 3998.5 | opposite-strand | Peptide methionine sulfoxide reductase |
| 5 | PF01103.25 | 0.9 | 18 | 2059 | same-strand | Omp85 superfamily domain |
| 6 | PF17243.4 | 0.95 | 19 | 2057.5 | same-strand | POTRA domain TamA domain 1 |
| 7 | PF04357.15 | 0.95 | 19 | -125.0 | same-strand | TamB, inner membrane protein subunit of TAM complex |
| 8 | PF06094.14 | 0.95 | 19 | 1595.0 | same-strand | Gamma-glutamyl cyclotransferase, AIG2-like |
| 9 | PF00719.21 | 0.7 | 14 | 2913 | opposite-strand | Inorganic pyrophosphatase |
++ More..