Result : EXP00705
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00705 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3804256 |
| Right | 3804426 |
| Strand | + |
| Nucleotide Sequence | ATCAGCAGGATCTATGTGAACGCTATTCAGGACGGGTCACACGCGCAAAAAAAAGCCAGCCTGTTTCCAGACTGGCTTTTGTGCTTTTCAAGCCGGTGTTACATCGCTTTTTTGGTCAACTCGATAACGCGCAGCTGCGCGATCGCTTTGGCCAGTTCCGCAGACGCCTGA |
| Sequence | ISRIYVNAIQDGSHAQKKASLFPDWLLCFSSRCYIAFLVNSITRSCAIALASSADA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4240811 | 4240966 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 4709039 | 4709194 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 3915470 | 3915625 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12849.9 | 1.0 | 2 | 4849.5 | opposite-strand | PBP superfamily domain |
| 2 | PF12727.9 | 1.0 | 2 | 4849.5 | opposite-strand | PBP superfamily domain |
| 3 | PF01380.24 | 1.0 | 2 | 1801 | opposite-strand | SIS domain |
| 4 | PF13537.8 | 1.0 | 2 | 1801 | opposite-strand | Glutamine amidotransferase domain |
| 5 | PF00132.26 | 1.0 | 2 | 269 | opposite-strand | Bacterial transferase hexapeptide (six repeats) |
| 6 | PF00483.25 | 1.0 | 2 | 269 | opposite-strand | Nucleotidyl transferase |
| 7 | PF14602.8 | 1.0 | 2 | 269 | opposite-strand | Hexapeptide repeat of succinyl-transferase |
| 8 | PF02823.18 | 1.0 | 2 | -72 | opposite-strand | ATP synthase, Delta/Epsilon chain, beta-sandwich domain |
| 9 | PF00401.22 | 1.0 | 2 | -72 | opposite-strand | ATP synthase, Delta/Epsilon chain, long alpha-helix domain |
| 10 | PF00006.27 | 1.0 | 2 | 1529.5 | opposite-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 11 | PF02874.25 | 1.0 | 2 | 1529.5 | opposite-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 12 | PF00231.21 | 1.0 | 2 | 1777 | opposite-strand | ATP synthase |
| 13 | PF00306.29 | 1.0 | 2 | 2691 | opposite-strand | ATP synthase alpha/beta chain, C terminal domain |
| 14 | PF00213.20 | 1.0 | 2 | 4245 | opposite-strand | ATP synthase delta (OSCP) subunit |
++ More..