Result : EXP00703
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00703 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 4239004 |
| Right | 4239102 |
| Strand | + |
| Nucleotide Sequence | ATGATATTGACCACGAGATTGCCGATTTGCAGGCGAAACGTACCCGCCTGGTGCAGCAACATCCGCGAATTGATGAATAAGCTGAAACGGATGGCCTGA |
| Sequence | MILTTRLPICRRNVPAWCSNIRELMNKLKRMA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5186501 | 5186599 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4331925 | 4332023 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4151815 | 4151913 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 4276533 | 4276613 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 357912 | 357992 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 4344257 | 4344355 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06983.15 | 0.8 | 4 | 5786 | opposite-strand | 3-demethylubiquinone-9 3-methyltransferase |
| 2 | PF00903.27 | 0.6 | 3 | 5745.0 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 3 | PF03831.16 | 0.8 | 4 | 5192 | opposite-strand | PhnA domain |
| 4 | PF08274.14 | 0.8 | 4 | 5192 | opposite-strand | PhnA Zinc-Ribbon |
| 5 | PF00350.25 | 0.6 | 3 | 2571.0 | same-strand | Dynamin family |
| 6 | PF01926.25 | 0.6 | 3 | 2571.0 | same-strand | 50S ribosome-binding GTPase |
| 7 | PF13990.8 | 0.8 | 4 | 1687 | same-strand | YjcZ-like protein |
| 8 | PF00083.26 | 1.0 | 5 | -79.0 | same-strand | Sugar (and other) transporter |
| 9 | PF08946.12 | 1.0 | 5 | -79.0 | same-strand | Osmosensory transporter coiled coil |
| 10 | PF02518.28 | 1.0 | 5 | 158.0 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 11 | PF00512.27 | 1.0 | 5 | 158.0 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 12 | PF00672.27 | 0.6 | 3 | 158.0 | opposite-strand | HAMP domain |
| 13 | PF00072.26 | 0.8 | 4 | 1259 | opposite-strand | Response regulator receiver domain |
| 14 | PF00486.30 | 1.0 | 5 | 1259.0 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 15 | PF00884.25 | 1.0 | 5 | 1924.0 | opposite-strand | Sulfatase |
| 16 | PF08019.14 | 1.0 | 5 | 1924.0 | opposite-strand | Phosphoethanolamine transferase EptA/EptB |
| 17 | PF13520.8 | 0.8 | 4 | 3671 | opposite-strand | Amino acid permease |
| 18 | PF00324.23 | 0.8 | 4 | 3671 | opposite-strand | Amino acid permease |
++ More..