ProsmORF-pred
Result : EXP00702
Protein Information
Information Type Description
Protein name EXP00702
NCBI Accession ID CP001509.3
Organism Escherichia coli BL21(DE3)
Left 3811487
Right 3811579
Strand +
Nucleotide Sequence GTGCTTCAGATCACATATTGCGCATGTTCGCGCACAGCATATTTATTTACTTGGCAAATGATGCCTTTGCAAGTTTATGATATTTCAGTCTAA
Sequence VLQITYCACSRTAYLFTWQMMPLQVYDISV
Source of smORF Ribo-seq
Function
Pubmed ID 30904393
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 30
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 5
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 4716255 4716347 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
2 3922686 3922778 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 3929953 3930045 + NC_004337.2 Shigella flexneri 2a str. 301
4 4248027 4248119 + NZ_CP061527.1 Shigella dysenteriae
5 4420332 4420424 - NZ_LR134340.1 Escherichia marmotae
6 3889570 3889662 + NZ_AP014857.1 Escherichia albertii
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_002695.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00213.20 1.0 5 2283.0 opposite-strand ATP synthase delta (OSCP) subunit
2 PF00430.20 1.0 5 1798.0 opposite-strand ATP synthase B/B' CF(0)
3 PF00137.23 1.0 5 1497.0 opposite-strand ATP synthase subunit C
4 PF00119.22 1.0 5 635.0 opposite-strand ATP synthase A chain
5 PF03899.17 1.0 5 246.0 opposite-strand ATP synthase I chain
6 PF02527.17 1.0 5 279.0 opposite-strand rRNA small subunit methyltransferase G
7 PF01134.24 1.0 5 966.0 opposite-strand Glucose inhibited division protein A
8 PF13932.8 1.0 5 966.0 opposite-strand tRNA modifying enzyme MnmG/GidA C-terminal domain
9 PF00258.27 1.0 5 3234.0 opposite-strand Flavodoxin
10 PF01037.23 1.0 5 3767.0 opposite-strand Lrp/AsnC ligand binding domain
11 PF13412.8 1.0 5 3767.0 opposite-strand Winged helix-turn-helix DNA-binding
12 PF13404.8 1.0 5 3767.0 opposite-strand AsnC-type helix-turn-helix domain
13 PF03590.17 1.0 5 4377.0 same-strand Aspartate-ammonia ligase
++ More..