Result : EXP00701
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00701 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1702947 |
| Right | 1703165 |
| Strand | + |
| Nucleotide Sequence | ATGGCGCACATTGTGCGCCATTTTTTTTGTCTGCCGTTTACCGCTACTGCGTCACGCGTAACATATTCCCTTGCTCTGGTTCACCATTCTGCGCTGACTCTACTGAAGGCGCATTGCTGGCTGCGGGAGTTGCTCCACTGCTCACCGAAACCGGATACCCTGCCCGACGATACAACGCTTTATCGACTAACTTCTGATCTACAGCCTTATTGTCTTTAA |
| Sequence | MAHIVRHFFCLPFTATASRVTYSLALVHHSALTLLKAHCWLRELLHCSPKPDTLPDDTTLYRLTSDLQPYCL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1757678 | 1757896 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1739249 | 1739473 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2357520 | 2357744 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1864153 | 1864377 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2061203 | 2061421 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1692354 | 1692542 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00037.29 | 0.6 | 3 | 3205.5 | opposite-strand | 4Fe-4S binding domain |
| 2 | PF12837.9 | 0.6 | 3 | 3205.5 | opposite-strand | 4Fe-4S binding domain |
| 3 | PF12838.9 | 0.6 | 3 | 3205.5 | opposite-strand | 4Fe-4S dicluster domain |
| 4 | PF13237.8 | 0.6 | 3 | 3205.5 | opposite-strand | 4Fe-4S dicluster domain |
| 5 | PF13247.8 | 0.6 | 3 | 3205.5 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF13187.8 | 0.6 | 3 | 3205.5 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF12797.9 | 0.6 | 3 | 3205.5 | opposite-strand | 4Fe-4S binding domain |
| 8 | PF10965.10 | 1.0 | 5 | 2545.0 | opposite-strand | Protein of unknown function (DUF2767) |
| 9 | PF00224.23 | 1.0 | 5 | 568.0 | same-strand | Pyruvate kinase, barrel domain |
| 10 | PF02887.18 | 1.0 | 5 | 568.0 | same-strand | Pyruvate kinase, alpha/beta domain |
| 11 | PF04728.15 | 1.0 | 5 | 17.5 | same-strand | Lipoprotein leucine-zipper |
| 12 | PF17969.3 | 1.0 | 5 | -175.0 | opposite-strand | L,D-transpeptidase C-terminal domain |
| 13 | PF03734.16 | 1.0 | 5 | -175.0 | opposite-strand | L,D-transpeptidase catalytic domain |
| 14 | PF01476.22 | 1.0 | 5 | -175.0 | opposite-strand | LysM domain |
| 15 | PF02657.17 | 1.0 | 5 | 978.0 | opposite-strand | Fe-S metabolism associated domain |
| 16 | PF00266.21 | 0.8 | 4 | 1407 | opposite-strand | Aminotransferase class-V |
| 17 | PF01458.19 | 0.8 | 4 | 2624 | opposite-strand | SUF system FeS cluster assembly, SufBD |
| 18 | PF00005.29 | 0.6 | 3 | 3870.0 | opposite-strand | ABC transporter |
++ More..