Result : EXP00700
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00700 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1665608 |
| Right | 1665787 |
| Strand | + |
| Nucleotide Sequence | ATGATATTATGCTCAAGTTTTGCGATGAGCGTAATCAGTTGCTCCAGTTCCTCTGCGGAGATGCCATGTAATATTTCCGCGCGGGTTTTGTTAATAACAGCTTCCATTTCGCTGATCAGCGGCTCTGCCTTTTCCGTCAGTTTAATACGTTTAGCCCGACGATCGCTGGCACAAGTTTGA |
| Sequence | MILCSSFAMSVISCSSSSAEMPCNISARVLLITASISLISGSAFSVSLIRLARRSLAQV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1698514 | 1698693 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1720412 | 1720591 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1658298 | 1658453 | + | NZ_AP014857.1 | Escherichia albertii |
| 4 | 2088461 | 2088640 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1902928 | 1903107 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 2320275 | 2320454 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 1592611 | 1592814 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 3666668 | 3666826 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 1969438 | 1969623 | - | NC_015968.1 | Enterobacter soli |
| 10 | 1525105 | 1525254 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 884140 | 884316 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 12 | 2023862 | 2024038 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 13 | 430190 | 430369 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 14 | 4789627 | 4789806 | + | NZ_CP026047.1 | Raoultella planticola |
| 15 | 2480391 | 2480570 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 16 | 3322151 | 3322300 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 17 | 530270 | 530446 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 18 | 2542398 | 2542589 | - | NZ_CP050508.1 | Raoultella terrigena |
| 19 | 956725 | 956931 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 20 | 2169063 | 2169269 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 21 | 2859670 | 2859849 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 22 | 2036040 | 2036219 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 23 | 1439649 | 1439825 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 24 | 2706102 | 2706248 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 25 | 2315895 | 2316071 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 26 | 2022705 | 2022884 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 27 | 3497426 | 3497605 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 28 | 2036222 | 2036392 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 29 | 3744584 | 3744790 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 30 | 3805860 | 3806066 | + | NZ_CP019706.1 | Pantoea alhagi |
| 31 | 1827386 | 1827565 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 32 | 2753954 | 2754133 | + | NZ_CP071320.1 | Serratia ureilytica |
| 33 | 2354090 | 2354269 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 34 | 2014642 | 2014791 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 35 | 2047604 | 2047753 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 36 | 1966321 | 1966470 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 37 | 2445316 | 2445525 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 38 | 4253908 | 4254087 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 39 | 2859002 | 2859190 | + | NZ_CP023525.1 | Cedecea neteri |
| 40 | 3043085 | 3043264 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 41 | 2172434 | 2172613 | - | NC_012962.1 | Photorhabdus asymbiotica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03702.16 | 0.97 | 39 | 941.0 | opposite-strand | Anhydro-N-acetylmuramic acid kinase |
| 2 | PF05433.17 | 0.97 | 39 | 122.0 | same-strand | Glycine zipper 2TM domain |
| 3 | PF01047.24 | 1.0 | 40 | -179 | opposite-strand | MarR family |
| 4 | PF12802.9 | 1.0 | 40 | -179 | opposite-strand | MarR family |
| 5 | PF13463.8 | 1.0 | 40 | -179 | opposite-strand | Winged helix DNA-binding domain |
| 6 | PF07869.14 | 0.7 | 28 | 397 | same-strand | Protein of unknown function (DUF1656) |
| 7 | PF13533.8 | 0.8 | 32 | 648 | same-strand | Biotin-lipoyl like |
| 8 | PF04632.14 | 0.8 | 32 | 1521 | same-strand | Fusaric acid resistance protein family |
| 9 | PF00080.22 | 0.65 | 26 | 3539 | opposite-strand | Copper/zinc superoxide dismutase (SODC) |
| 10 | PF01243.22 | 0.8 | 32 | 2445 | opposite-strand | Pyridoxamine 5'-phosphate oxidase |
| 11 | PF10590.11 | 0.8 | 32 | 2445 | opposite-strand | Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region |
| 12 | PF09864.11 | 0.82 | 33 | 2110.5 | opposite-strand | Membrane-bound lysozyme-inhibitor of c-type lysozyme |
| 13 | PF13515.8 | 0.75 | 30 | 1521 | same-strand | Fusaric acid resistance protein-like |
++ More..