Result : EXP00697
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00697 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 4083863 |
| Right | 4083958 |
| Strand | + |
| Nucleotide Sequence | ATCTGCCTATCAGCACCACTTCTTTTCTCCTCCCTGTTTTTTCCTTCTGTTTATTGCATTCAACAAGTCGGGCATGTTGCCTGGTTGATGTGGTGA |
| Sequence | ICLSAPLLFSSLFFPSVYCIQQVGHVAWLMW |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4984938 | 4985051 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4148232 | 4148345 | + | NZ_AP014857.1 | Escherichia albertii |
| 3 | 4175794 | 4175907 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4195546 | 4195659 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 3118827 | 3118940 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 215805 | 215918 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 108301 | 108414 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 318966 | 319076 | + | NZ_CP032487.1 | Yersinia hibernica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01177.24 | 0.71 | 5 | 9261 | same-strand | Asp/Glu/Hydantoin racemase |
| 2 | PF02873.18 | 1.0 | 7 | 2709.0 | same-strand | UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain |
| 3 | PF01565.25 | 1.0 | 7 | 2709.0 | same-strand | FAD binding domain |
| 4 | PF03099.21 | 1.0 | 7 | 1747.0 | same-strand | Biotin/lipoate A/B protein ligase family |
| 5 | PF08279.14 | 0.86 | 6 | 1747 | same-strand | HTH domain |
| 6 | PF02237.19 | 1.0 | 7 | 1747.0 | same-strand | Biotin protein ligase C terminal domain |
| 7 | PF00009.29 | 1.0 | 7 | 37.0 | same-strand | Elongation factor Tu GTP binding domain |
| 8 | PF03143.19 | 1.0 | 7 | 37.0 | same-strand | Elongation factor Tu C-terminal domain |
| 9 | PF03144.27 | 1.0 | 7 | 37.0 | same-strand | Elongation factor Tu domain 2 |
| 10 | PF01926.25 | 1.0 | 7 | 37.0 | same-strand | 50S ribosome-binding GTPase |
| 11 | PF00584.22 | 1.0 | 7 | 1451.0 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
| 12 | PF02357.21 | 1.0 | 7 | 1836.0 | same-strand | Transcription termination factor nusG |
| 13 | PF00467.31 | 1.0 | 7 | 1836.0 | same-strand | KOW motif |
| 14 | PF03946.16 | 1.0 | 7 | 2540.0 | same-strand | Ribosomal protein L11, N-terminal domain |
| 15 | PF00298.21 | 1.0 | 7 | 2540.0 | same-strand | Ribosomal protein L11, RNA binding domain |
| 16 | PF00687.23 | 1.0 | 7 | 2972.0 | same-strand | Ribosomal protein L1p/L10e family |
++ More..