Result : EXP00688
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00688 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3952743 |
| Right | 3952868 |
| Strand | + |
| Nucleotide Sequence | ATGTTTTTCTTGCGTGAAACGGGAGCCTTCAACGAAATTGACAATGGTGGTGGGATGCAGGCGAAACTTTTCACAAGAACGCCGAGTGGTTTCAACATCTTTACCACGTCGCTCCGGATGACGTAA |
| Sequence | MFFLRETGAFNEIDNGGGMQAKLFTRTPSGFNIFTTSLRMT |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4842085 | 4842210 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4046006 | 4046131 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4058693 | 4058818 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 4379523 | 4379648 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 149825 | 149944 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 6 | 5208709 | 5208843 | - | NZ_CP041247.1 | Raoultella electrica |
| 7 | 5517983 | 5518117 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06288.15 | 0.67 | 4 | 3668 | same-strand | Protein of unknown function (DUF1040) |
| 2 | PF01636.25 | 0.83 | 5 | 2605.0 | same-strand | Phosphotransferase enzyme family |
| 3 | PF01323.22 | 0.83 | 5 | 1962.0 | same-strand | DSBA-like thioredoxin domain |
| 4 | PF13462.8 | 0.83 | 5 | 1962.0 | same-strand | Thioredoxin |
| 5 | PF01553.23 | 0.83 | 5 | -125.0 | opposite-strand | Acyltransferase |
| 6 | PF00476.22 | 1.0 | 6 | 835 | same-strand | DNA polymerase family A |
| 7 | PF02739.18 | 1.0 | 6 | 835 | same-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
| 8 | PF01612.22 | 1.0 | 6 | 835 | same-strand | 3'-5' exonuclease |
| 9 | PF01367.22 | 1.0 | 6 | 835 | same-strand | 5'-3' exonuclease, C-terminal SAM fold |
| 10 | PF01926.25 | 1.0 | 6 | 4002 | opposite-strand | 50S ribosome-binding GTPase |
| 11 | PF02421.20 | 1.0 | 6 | 4002 | opposite-strand | Ferrous iron transport protein B |
| 12 | PF04220.14 | 1.0 | 6 | 5216 | same-strand | Der GTPase activator (YihI) |
| 13 | PF04055.23 | 1.0 | 6 | 5912 | same-strand | Radical SAM superfamily |
| 14 | PF06969.18 | 1.0 | 6 | 5912 | same-strand | HemN C-terminal domain |
++ More..