Result : EXP00687
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00687 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 743018 |
| Right | 743140 |
| Strand | + |
| Nucleotide Sequence | GTGAAAATTGCACGGCGAGTAGGGCGAAAAGCAGGGCGGCAGTATCGGTCAACATATGACCCGCATCGGCCAGCAATGCCAGAGAACCAGAAAGAAAACCACCAACGACTTCTACCAGCATAA |
| Sequence | VKIARRVGRKAGRQYRSTYDPHRPAMPENQKENHQRLLPA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 784610 | 784732 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 573441 | 573563 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2958142 | 2958264 | - | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00691.22 | 1.0 | 3 | 4175 | same-strand | OmpA family |
| 2 | PF16331.7 | 1.0 | 3 | 3374 | same-strand | TolA binding protein trimerisation |
| 3 | PF13174.8 | 1.0 | 3 | 3374 | same-strand | Tetratricopeptide repeat |
| 4 | PF13432.8 | 1.0 | 3 | 3374 | same-strand | Tetratricopeptide repeat |
| 5 | PF02445.18 | 1.0 | 3 | 1482 | same-strand | Quinolinate synthetase A protein |
| 6 | PF04973.14 | 1.0 | 3 | 725 | same-strand | Nicotinamide mononucleotide transporter |
| 7 | PF01545.23 | 1.0 | 3 | -122 | opposite-strand | Cation efflux family |
| 8 | PF13985.8 | 1.0 | 3 | 205 | opposite-strand | YbgS-like protein |
| 9 | PF00793.22 | 1.0 | 3 | 901 | same-strand | DAHP synthetase I family |
| 10 | PF00300.24 | 0.67 | 2 | 2115.5 | opposite-strand | Histidine phosphatase superfamily (branch 1) |
| 11 | PF01263.22 | 0.67 | 2 | 3070.0 | opposite-strand | Aldose 1-epimerase |
| 12 | PF07676.14 | 0.67 | 2 | 4696.0 | same-strand | WD40-like Beta Propeller Repeat |
| 13 | PF04052.15 | 0.67 | 2 | 4696.0 | same-strand | TolB amino-terminal domain |
++ More..