Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem II protein Y |
NCBI Accession ID | CP000951.1 |
Organism | Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum) |
Left | 1402862 |
Right | 1402978 |
Strand | + |
Nucleotide Sequence | ATGGATTGGCGAGTTGTTGTTGTTTTAGCTCCCGTAATCATCGCTGGCTCTTGGGCAATCTTTAACATTGCTGCGGCTGCCCTGAACCAACTCCGCAATATGCAAACGAAGAAATAA |
Sequence | MDWRVVVVLAPVIIAGSWAIFNIAAAALNQLRNMQTKK |
Source of smORF | Swiss-Prot |
Function | Manganese-binding polypeptide with L-arginine metabolizing enzyme activity. Component of the core of photosystem II. {ECO:0000255|HAMAP-Rule:MF_00717}. |
Pubmed ID | |
Domain | CDD:421422 |
Functional Category | Others |
Uniprot ID | B1XLQ0 |
ORF Length (Amino Acid) | 38 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2610605 | 2610730 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
2 | 2741148 | 2741267 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
3 | 2357303 | 2357422 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
4 | 6518863 | 6518991 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
5 | 8289703 | 8289828 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
6 | 6197922 | 6198047 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
7 | 2995960 | 2996085 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
8 | 2940696 | 2940818 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
9 | 4688354 | 4688473 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
10 | 947971 | 948090 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
11 | 950932 | 951054 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
12 | 5803049 | 5803174 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
13 | 473466 | 473591 | - | NZ_CP031941.1 | Nostoc sphaeroides |
14 | 2454007 | 2454132 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
15 | 3144518 | 3144640 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
16 | 328800 | 328925 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
17 | 5045337 | 5045462 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
18 | 3826935 | 3827045 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
19 | 1271877 | 1271996 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
20 | 1337637 | 1337762 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09654.12 | 0.75 | 15 | 960 | opposite-strand | Protein of unknown function (DUF2396) |
2 | PF00132.26 | 0.8 | 16 | 171.0 | same-strand | Bacterial transferase hexapeptide (six repeats) |
3 | PF14602.8 | 0.8 | 16 | 171.0 | same-strand | Hexapeptide repeat of succinyl-transferase |