Result : EXP00684
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00684 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 445504 |
| Right | 445659 |
| Strand | + |
| Nucleotide Sequence | TTGGTTCTCCCGCAACGCTACTCTGTTTACCAGGTCAGGTCCGGAAGGAAGCAGCCAAGGCAGATGACGCGTGTGCCGGGATGTAGCTGGCAGGGCCCCCACCCATTTCTGCCTCCCACCGTTTCGTCAAAAAAAACCAACATGGCTAAACTTTAA |
| Sequence | LVLPQRYSVYQVRSGRKQPRQMTRVPGCSWQGPHPFLPPTVSSKKTNMAKL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1611035 | 1611190 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 2 | 3237514 | 3237669 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 476458 | 476613 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 542524 | 542679 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 412989 | 413144 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 1121336 | 1121485 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 1218334 | 1218492 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 8 | 494451 | 494618 | + | NZ_AP014857.1 | Escherichia albertii |
| 9 | 4260327 | 4260485 | - | NZ_CP054254.1 | Klebsiella variicola |
| 10 | 1282620 | 1282766 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 11 | 1137384 | 1137521 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 12 | 1038147 | 1038314 | + | NC_015968.1 | Enterobacter soli |
| 13 | 1924729 | 1924866 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 14 | 1091686 | 1091832 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 15 | 1134645 | 1134782 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 16 | 1931405 | 1931542 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 17 | 4612937 | 4613086 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP057657.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01035.22 | 0.94 | 15 | 170.0 | opposite-strand | 6-O-methylguanine DNA methyltransferase, DNA binding domain |
| 2 | PF09619.12 | 0.88 | 14 | 518 | same-strand | Type III secretion system lipoprotein chaperone (YscW) |
| 3 | PF02551.17 | 0.94 | 15 | 1298.5 | opposite-strand | Acyl-CoA thioesterase |
| 4 | PF13622.8 | 0.94 | 15 | 1298.5 | opposite-strand | Thioesterase-like superfamily |
| 5 | PF00909.23 | 0.81 | 13 | 2232.5 | same-strand | Ammonium Transporter Family |
++ More..