Result : EXP00676
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00676 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 639083 |
| Right | 639175 |
| Strand | + |
| Nucleotide Sequence | ATGTCGATGAGCCAACACCTGAAAACCATGAAGAAAAAAATGATGAGGGTGAAAAACCACAGAGCATTACCAGCATTATCAAAATCAGTTTAA |
| Sequence | MSMSQHLKTMKKKMMRVKNHRALPALSKSV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 668910 | 669002 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 681518 | 681610 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 762879 | 762971 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1504651 | 1504743 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 1317640 | 1317732 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 1.0 | 4 | 2920 | opposite-strand | ABC transporter |
| 2 | PF02463.21 | 1.0 | 4 | 2920 | opposite-strand | RecF/RecN/SMC N terminal domain |
| 3 | PF01156.21 | 1.0 | 4 | 1867 | opposite-strand | Inosine-uridine preferring nucleoside hydrolase |
| 4 | PF06889.13 | 1.0 | 4 | 1303.0 | same-strand | Protein of unknown function (DUF1266) |
| 5 | PF08238.14 | 1.0 | 4 | 2112 | opposite-strand | Sel1 repeat |
| 6 | PF00528.24 | 0.75 | 3 | 3696 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
++ More..