ProsmORF-pred
Result : B1XI93
Protein Information
Information Type Description
Protein name NAD(P)H-quinone oxidoreductase subunit O (EC 7.1.1.-) (NAD(P)H dehydrogenase I subunit O) (NDH-1 subunit O) (NDH-O)
NCBI Accession ID CP000951.1
Organism Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)
Left 2170553
Right 2170768
Strand -
Nucleotide Sequence ATGGCGGCTAAACTAAAGAAAGGAAGCCTTGTGCGGGTGATTAAAGAACAATTCACCAATAGCCTCGAAGCGAAAGCGAGTGATTCCCGTTTACCCGCCTACTTTTTCGGAAGCCAAGGCGAAATCCTCGATCTCGACGATGAATACGCCTTTGTGCGTTTCTATACCCCAACTCCCAGTGTTTGGCTCCGTCTCGATCAACTCGAAGCTGTTTAA
Sequence MAAKLKKGSLVRVIKEQFTNSLEAKASDSRLPAYFFGSQGEILDLDDEYAFVRFYTPTPSVWLRLDQLEAV
Source of smORF Swiss-Prot
Function NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration. {ECO:0000255|HAMAP-Rule:MF_01354}.
Pubmed ID
Domain CDD:403201
Functional Category Others
Uniprot ID B1XI93
ORF Length (Amino Acid) 71
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 31
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3327912 3328130 - NC_014501.1 Gloeothece verrucosa PCC 7822
2 2422722 2422940 + NC_011729.1 Gloeothece citriformis PCC 7424
3 3576317 3576535 - NC_019776.1 Cyanobacterium aponinum PCC 10605
4 2073398 2073616 - NC_019689.1 Pleurocapsa sp. PCC 7327
5 2771496 2771714 + NC_019748.1 Stanieria cyanosphaera PCC 7437
6 2937240 2937455 - NC_019780.1 Dactylococcopsis salina PCC 8305
7 827764 827979 - NC_010296.1 Microcystis aeruginosa NIES-843
8 777203 777421 - NZ_CP042326.1 Euhalothece natronophila Z-M001
9 908770 908991 + NZ_CP021983.2 Halomicronema hongdechloris C2206
10 3698290 3698505 - NC_019753.1 Crinalium epipsammum PCC 9333
11 6621550 6621741 + NC_019751.1 Calothrix sp. PCC 6303
12 2132462 2132671 - NC_009925.1 Acaryochloris marina MBIC11017
13 1154292 1154474 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
14 5463038 5463232 + NZ_CP031941.1 Nostoc sphaeroides
15 4128199 4128393 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
16 2361092 2361274 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
17 2899107 2899301 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
18 4950826 4951020 - NC_010628.1 Nostoc punctiforme PCC 73102
19 1843089 1843283 + NC_019771.1 Anabaena cylindrica PCC 7122
20 5492770 5492985 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
21 3497194 3497388 - NC_014248.1 'Nostoc azollae' 0708
22 17096 17284 - NZ_AP018202.1 Thermostichus vulcanus NIES-2134
23 17096 17284 - NC_004113.1 Thermosynechococcus vestitus BP-1
24 6744353 6744547 + NC_019693.1 Oscillatoria acuminata PCC 6304
25 2851801 2851992 + NZ_CP047242.1 Trichormus variabilis 0441
26 1733281 1733493 + NZ_CP018092.1 Synechococcus lividus PCC 6715
27 3266129 3266335 - NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
28 2872407 2872595 - NC_019675.1 Cyanobium gracile PCC 6307
29 3468414 3468617 - NC_022600.1 Gloeobacter kilaueensis JS1
30 3742956 3743159 - NC_005125.1 Gloeobacter violaceus PCC 7421
31 143984 144181 + NC_005042.1 Prochlorococcus marinus subsp. marinus str. CCMP1375
++ More..