Result : EXP00671
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00671 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1321518 |
| Right | 1321658 |
| Strand | + |
| Nucleotide Sequence | ATGAGGTTAGCAATGCCTTCTGGAAATCAGGAACCCCGCCGCGATCCTGAATTAAAACGTAAAGCCTGGCTGGCGGTTTTTCTTGGTTCTGCACTTTTCTGGGTGGTTGTCGCACTGCTGATTTGGAAAGTGTGGGGATAA |
| Sequence | MRLAMPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG |
| Source of smORF | Ribo-seq |
| Function | integral component of membrane [GO:0016021]; plasma membrane [GO:0005886];INDUCTION: Constitutively expressed (at protein level) Pubmed:19121005 The ORF matches to the profile of NF000536. Profile Description: YmiA family putative membrane protein. |
| Pubmed ID | 30904393 |
| Domain | CDD:333720 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0CB62 |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1835992 | 1836132 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1335148 | 1335288 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1329432 | 1329572 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2403198 | 2403338 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1320327 | 1320467 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 6 | 2959464 | 2959604 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 7 | 3992245 | 3992385 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 713231 | 713359 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 2674729 | 2674857 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 10 | 2514356 | 2514484 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 11 | 471813 | 471941 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 12 | 2590982 | 2591122 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 13 | 2598241 | 2598369 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 14 | 521053 | 521181 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 15 | 1837496 | 1837636 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 16 | 1807980 | 1808120 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 17 | 2231668 | 2231796 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 18 | 2035147 | 2035275 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 19 | 2981347 | 2981475 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 20 | 2047657 | 2047797 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 21 | 1779166 | 1779306 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 22 | 1400674 | 1400814 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 23 | 467763 | 467903 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 24 | 4319382 | 4319522 | - | NZ_CP053416.1 | Salmonella bongori |
| 25 | 2591133 | 2591273 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 26 | 2805711 | 2805851 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 27 | 2584323 | 2584463 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 28 | 2552483 | 2552623 | - | NC_015968.1 | Enterobacter soli |
| 29 | 4691739 | 4691879 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 30 | 858016 | 858156 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 31 | 4677386 | 4677526 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 32 | 2547398 | 2547538 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 33 | 378060 | 378200 | - | NZ_CP033744.1 | Citrobacter freundii |
| 34 | 2641373 | 2641513 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 35 | 1145580 | 1145708 | - | NZ_CP038469.1 | Citrobacter tructae |
| 36 | 1918841 | 1918981 | - | NZ_LR134201.1 | Cedecea lapagei |
| 37 | 2159084 | 2159224 | + | NZ_CP023525.1 | Cedecea neteri |
| 38 | 2162661 | 2162801 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 39 | 2323101 | 2323229 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 40 | 2098682 | 2098822 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 41 | 2391126 | 2391254 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 42 | 1632079 | 1632207 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 43 | 1062166 | 1062294 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 44 | 1833237 | 1833365 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 45 | 2389393 | 2389521 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 46 | 4142189 | 4142329 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 47 | 4089752 | 4089880 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 48 | 2675602 | 2675715 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 49 | 2558898 | 2559014 | - | NZ_CP045845.1 | Kluyvera intermedia |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009792.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00106.27 | 0.96 | 46 | 6082 | opposite-strand | short chain dehydrogenase |
| 2 | PF13561.8 | 0.75 | 36 | 6081 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 3 | PF08659.12 | 0.96 | 46 | 6082 | opposite-strand | KR domain |
| 4 | PF08496.12 | 1.0 | 48 | 4788 | same-strand | Peptidase family S49 N-terminal |
| 5 | PF01343.20 | 1.0 | 48 | 4788 | same-strand | Peptidase family S49 |
| 6 | PF10692.11 | 1.0 | 48 | 4498 | opposite-strand | Protein of unknown function (DUF2498) |
| 7 | PF01131.22 | 1.0 | 48 | 1504 | same-strand | DNA topoisomerase |
| 8 | PF08272.13 | 1.0 | 48 | 1504 | same-strand | Topoisomerase I zinc-ribbon-like |
| 9 | PF01751.24 | 1.0 | 48 | 1504 | same-strand | Toprim domain |
| 10 | PF01396.21 | 1.0 | 48 | 1504 | same-strand | Topoisomerase DNA binding C4 zinc finger |
| 11 | PF03466.22 | 1.0 | 48 | 339 | same-strand | LysR substrate binding domain |
| 12 | PF00126.29 | 1.0 | 48 | 339 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 13 | PF00330.22 | 0.98 | 47 | 582.5 | same-strand | Aconitase family (aconitate hydratase) |
| 14 | PF00694.21 | 0.98 | 47 | 582.5 | same-strand | Aconitase C-terminal domain |
| 15 | PF00925.22 | 0.98 | 47 | 3311.0 | opposite-strand | GTP cyclohydrolase II |
| 16 | PF01569.23 | 0.96 | 46 | 4091 | same-strand | PAP2 superfamily |
| 17 | PF06305.13 | 0.9 | 43 | 5000 | same-strand | Lipopolysaccharide assembly protein A domain |
| 18 | PF18073.3 | 0.62 | 30 | 5315.0 | same-strand | Rubredoxin metal binding domain |
++ More..